SecReT4
Protein ID: 217980285
T4SS name [ID]Tra_F [529]
Gene symbol-
Locus tagSbal223_4438
StrainShewanella baltica OS223
Repliconplasmid pS22302 [GenBank: NC_011668] [Browse all T4SS(s) in this replicon]
Location [Strand]24563..27151 [-]
Producttype-IV secretion system protein TraC
Component typeTraC_F
UniProt IDB8EFV3
KEGG IDsbp:Sbal223_4438
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 7.8e-49, Aligned region: 20..256
AAA_10 [PF12846], Evalue: 4e-45, Aligned region: 455..751
TrwB_AAD_bind [PF10412], Evalue: 3.9e-06, Aligned region: 452..518
Protein Sequence: 862 a.a.     [Download]
>gi|217980285|ref|YP_002364261.1| type-IV secretion system protein TraC [Shewanella baltica OS223]
MKQRIKNDLGALYASSKQQHNHLHHELPYRIYDDAEQVFENANSLGFGFAISLFGGANDDLIKTMNALVC
TLPEGDKWHYQFVMVGNNQVGELIEQNQALLSGRNAICDKFASNEAIYAKHSSTKGFGTKLSSAYHYDLK
NTKGFFFVSTTEDMPALLDMRLGIESELAQTGMHIRRLGADDLIEHCREHLNFSHQQDRVSPAKYNEYQP
LNTQILSPDSEFIINRDSVNIRHTPMQSDNSVDTTLINLGLKGLPNDFRLYAFPNCIASLSYTMNSVQCP
YRVSVSFYINKTGEQTTRNDSKIGSLTKTVNSPMRLLIPSAADELAERKEIQKGLSSHAFKITTMTLNVT
LYTTEEKHRHDTSKAIATFRTAGIDLIRNNKLQGMCTLSTLPFSMSEGFMKDSQKAGLCFMMKTSNLVNF
LPIVADYKRLSAGLLLPTMRHQISYFDPFNCGSDNYNMAITGGSGAGKSFFMQALVKSIFAKGGKAWILD
KGQSYKKLTQTLGGVYLDSSQIFLNPFTHLGKVLSVRDAGTFGPILDDEGQAIDPITEVLGNITALIATM
ASPDEKLTGFQTALLGDAILLAWQKCGNDTLIDDVQKALYDIAAQKNDDTRISDIAAQLNKFCSSGIHGA
IFNKPSMLDPNIDITTLELDGFKGELQRPVIFALMVTISQQMYLSGQRSIPKICVIEEAWSLMSGANAQS
KDFINEGYRTVRKFGGSFATVTQGMNDFFANAEAEAALNSSDIHITLRQGDGFGDFLNKHPDHFSPFEQH
MIKSFPRANDAGHSCVMLKAGGLVSFHRIFADPWSRAMLSTEPKEFEHCENLIKGGMPLLDAIELTAQHF
YPDDMARFDAILSAAATHKEAA
 
Nucleotide Sequence: 2589 bp     [Download]
>gi|217980264|ref|NC_011668.1|:c27151-24563 Shewanella baltica OS223 plasmid pS22302, complete sequence
ATGAAACAACGTATTAAAAACGATCTCGGCGCACTCTATGCCAGCAGCAAACAGCAACACAACCATCTGC
ATCATGAATTGCCCTATCGCATTTATGATGATGCTGAACAAGTCTTTGAAAATGCTAATTCGCTTGGTTT
TGGCTTTGCCATTTCGCTGTTTGGCGGGGCTAATGACGACTTAATCAAAACCATGAACGCCTTGGTGTGC
ACACTGCCAGAGGGCGACAAATGGCATTATCAATTCGTCATGGTCGGTAATAATCAAGTCGGTGAGCTCA
TCGAGCAAAATCAAGCGCTGCTCAGTGGCCGCAATGCCATTTGCGATAAATTTGCCTCAAATGAAGCTAT
CTATGCAAAACACAGTTCGACCAAAGGCTTTGGCACCAAGCTCAGCAGCGCATATCACTACGATCTAAAG
AACACTAAAGGGTTTTTCTTTGTGTCAACCACCGAAGATATGCCCGCACTGCTGGATATGCGTCTTGGCA
TTGAATCAGAGCTGGCGCAAACAGGCATGCACATTCGCCGCTTAGGCGCTGACGATCTGATTGAGCATTG
CCGCGAGCATTTAAATTTTTCGCATCAACAAGATCGCGTTTCGCCCGCTAAATATAACGAGTATCAACCT
CTCAACACCCAAATCCTCAGCCCTGACAGTGAGTTCATCATTAACCGTGATTCGGTCAATATCCGTCACA
CACCGATGCAATCAGACAACAGTGTCGATACCACCTTAATCAATCTTGGGCTAAAGGGGCTGCCGAACGA
CTTTAGGCTATATGCGTTTCCCAACTGTATTGCATCACTCAGTTACACCATGAACAGTGTTCAATGCCCT
TACCGTGTCAGCGTGTCTTTTTATATTAATAAAACGGGTGAGCAAACAACCCGTAACGACAGCAAAATTG
GATCTTTGACCAAAACGGTCAACTCCCCTATGCGGTTGTTAATCCCCAGTGCCGCGGATGAACTGGCTGA
ACGCAAGGAGATACAAAAAGGACTCAGCTCACACGCCTTTAAAATCACCACCATGACATTGAATGTCACC
CTGTATACGACAGAAGAGAAGCACCGCCACGACACCTCAAAGGCGATTGCGACATTTCGCACGGCAGGCA
TTGATTTAATCCGAAACAATAAACTGCAAGGCATGTGCACACTGTCCACCCTCCCGTTCTCAATGAGCGA
AGGCTTTATGAAAGACAGCCAAAAAGCGGGCCTGTGTTTCATGATGAAAACCTCAAACTTGGTGAACTTT
TTACCGATTGTTGCAGACTACAAACGCTTATCCGCAGGGTTACTCTTGCCAACAATGCGCCATCAAATTA
GCTATTTCGATCCGTTTAACTGCGGCAGTGATAACTACAACATGGCCATCACGGGCGGCTCAGGGGCAGG
GAAGTCATTCTTCATGCAAGCCTTGGTAAAATCGATTTTTGCCAAAGGGGGCAAGGCATGGATTCTTGAC
AAGGGTCAGAGTTACAAAAAACTCACTCAAACATTAGGCGGCGTCTATCTCGATAGTTCGCAGATTTTCC
TAAACCCGTTTACCCACTTAGGCAAAGTTTTAAGCGTGCGGGATGCGGGTACTTTTGGCCCTATCCTCGA
TGATGAAGGTCAAGCCATTGATCCCATCACCGAAGTGTTGGGAAACATCACCGCGCTTATCGCCACCATG
GCATCACCTGATGAAAAGCTCACCGGATTTCAGACGGCATTACTCGGCGATGCTATTTTGCTGGCATGGC
AAAAATGCGGTAACGACACGCTGATTGACGATGTGCAAAAGGCACTCTATGACATTGCCGCACAAAAAAA
TGACGATACCCGTATCAGTGATATCGCTGCGCAATTAAACAAGTTCTGTTCAAGCGGTATTCATGGCGCA
ATTTTCAATAAGCCCTCGATGCTCGATCCCAATATTGACATTACCACGCTGGAACTTGATGGATTTAAAG
GCGAGCTACAACGTCCGGTGATTTTCGCGTTGATGGTGACGATTAGCCAACAAATGTACTTATCGGGCCA
ACGTTCTATTCCGAAAATCTGTGTGATTGAAGAAGCGTGGTCACTCATGAGCGGCGCGAATGCGCAAAGT
AAGGATTTCATCAACGAAGGTTATCGCACAGTGCGTAAGTTCGGCGGCAGCTTTGCCACAGTAACGCAAG
GCATGAACGACTTCTTTGCCAACGCCGAGGCCGAAGCGGCACTGAACAGTTCAGATATTCATATCACCTT
GCGCCAAGGTGATGGCTTTGGGGATTTCTTGAACAAGCATCCTGACCACTTCTCGCCCTTCGAGCAACAC
ATGATCAAGTCATTCCCCCGCGCCAATGATGCGGGTCATTCCTGCGTGATGCTCAAAGCGGGCGGGCTAG
TGTCCTTTCACCGGATTTTTGCCGATCCATGGTCGCGCGCCATGCTCTCAACCGAGCCGAAAGAATTTGA
GCATTGTGAGAACCTTATTAAAGGCGGCATGCCGTTACTCGATGCCATTGAACTGACAGCCCAACATTTC
TATCCCGATGATATGGCTCGTTTTGATGCCATTTTGTCCGCAGCAGCAACCCACAAAGAGGCCGCATAA
 Primer design