SecReT4
Protein ID: 217980286
T4SS name [ID]Tra_F [529]
Gene symbol-
Locus tagSbal223_4439
StrainShewanella baltica OS223
Repliconplasmid pS22302 [GenBank: NC_011668] [Browse all T4SS(s) in this replicon]
Location [Strand]27155..27613 [-]
Producttype IV conjugative transfer system protein TraV
Component typeTraV_F
UniProt IDB8EFV4
KEGG IDsbp:Sbal223_4439
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 5.4e-24, Aligned region: 33..141
Protein Sequence: 152 a.a.     [Download]
>gi|217980286|ref|YP_002364262.1| type IV conjugative transfer system protein TraV [Shewanella baltica OS223]
MLNTIMSKNALRNTGIIALASWLLSGCAAGLDSDYSCDKVGGINGCTNMMEVRQLTDSGVFNQPQAQSPA
VTALSGQSTTALPKLASQQQDFIPLPRRDRHGVPLRTSESVQKVTIFPYLNEQGDYVDTSDVYIVVDKSR
WTGRPAKYIKQD
 
Nucleotide Sequence: 459 bp     [Download]
>gi|217980264|ref|NC_011668.1|:c27613-27155 Shewanella baltica OS223 plasmid pS22302, complete sequence
ATGTTGAACACAATCATGAGCAAAAACGCATTACGTAACACCGGTATTATCGCACTGGCTTCATGGCTAT
TAAGTGGCTGTGCGGCGGGGCTAGATAGTGACTATTCCTGCGATAAAGTCGGCGGCATCAATGGCTGTAC
CAATATGATGGAAGTGAGGCAACTCACCGACAGTGGTGTGTTCAATCAGCCACAAGCACAAAGCCCTGCG
GTGACAGCCTTAAGCGGCCAAAGCACAACTGCACTTCCCAAGCTCGCGAGCCAACAACAAGACTTTATCC
CTTTGCCACGCCGCGACCGCCACGGTGTACCGCTGCGCACCTCTGAGTCAGTCCAAAAAGTAACCATCTT
CCCGTATCTCAATGAGCAAGGTGATTACGTTGATACCAGCGATGTCTACATCGTGGTCGATAAGAGCCGT
TGGACGGGTAGACCTGCCAAATACATCAAGCAGGATTAA
 Primer design