SecReT4
Protein ID: 217980287
T4SS name [ID]Tra_F [529]
Gene symbol-
Locus tagSbal223_4440
StrainShewanella baltica OS223
Repliconplasmid pS22302 [GenBank: NC_011668] [Browse all T4SS(s) in this replicon]
Location [Strand]27631..29157 [-]
ProductTraB pilus assembly family protein
Component typeTraB_F
UniProt IDB8EFV5
KEGG IDsbp:Sbal223_4440
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.9e-38, Aligned region: 234..432
Protein Sequence: 508 a.a.     [Download]
>gi|217980287|ref|YP_002364263.1| TraB pilus assembly family protein [Shewanella baltica OS223]
MKQLLDYFKKDPEADFEQGSALNEANKKRNWVIAGVGATVLGALYLAGDAYMSAPKRAPETAAGNPIDFG
AVIDKDFTEKDNQSALTAQQIALDKQQKAIDKILSSMQAIERNNEANRLDLKRNLETFQLTITERIDDKI
NAANANAMQHSNVTDEFSTEGIDASAYPVRQSTRYLGEQTLPPRPSVGDGQSGYAAPYQGGAIPPPATQN
GIDSFALNWETPEENLPKKRTPENYVPAGTFVTAVVTGGADANAGVNGQGDTVPMVFQTTNQGVLPNGKP
SKLNNCTVLGAAYGEISSSRGIVRTTRLSCIFEDEIIDIPVEATVFNYGRNGIRGTAIMKNGKIVQMAGI
SGILTGIGETGKALSQTTSNSALGSTSSVNGSDALLNLAGSASSSVGSKLADYYIKLAEQYHPIIELNPG
NTVNIVFLKGFPLDPVGIQEYEEALAQQAQNPVSATAQILNTISNPLLEQMPGNIKPQAQGTNTPTPQQQ
YNQQGQRPPVNSAFGRAN
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|217980264|ref|NC_011668.1|:c29157-27631 Shewanella baltica OS223 plasmid pS22302, complete sequence
ATGAAGCAACTCCTAGACTACTTCAAAAAGGACCCCGAAGCCGACTTTGAGCAAGGCAGTGCGTTAAATG
AAGCCAATAAAAAACGCAATTGGGTGATTGCAGGTGTGGGGGCAACGGTACTCGGTGCCCTCTATTTAGC
GGGCGACGCCTATATGTCTGCCCCTAAACGTGCCCCCGAAACCGCAGCGGGCAATCCTATCGATTTTGGT
GCCGTGATTGATAAAGATTTCACCGAGAAAGACAATCAGTCTGCGCTCACCGCACAACAAATTGCCTTAG
ATAAGCAGCAGAAAGCGATTGATAAAATACTGAGCAGCATGCAAGCCATTGAGCGCAACAATGAAGCTAA
TCGCCTTGATTTAAAACGTAATTTAGAGACATTCCAACTAACCATCACTGAAAGAATTGATGATAAGATT
AATGCAGCAAACGCAAATGCAATGCAGCATAGCAATGTCACCGATGAATTTTCGACAGAGGGCATCGATG
CATCTGCCTATCCCGTTAGGCAAAGCACACGCTACTTAGGTGAACAAACGCTGCCGCCACGCCCGAGCGT
GGGTGACGGACAAAGCGGGTATGCTGCCCCCTATCAAGGCGGCGCTATCCCGCCACCTGCAACCCAAAAT
GGCATCGATTCCTTTGCATTAAATTGGGAAACGCCAGAAGAAAACCTGCCAAAAAAACGCACCCCTGAGA
ACTATGTTCCTGCAGGTACGTTTGTCACAGCTGTCGTTACGGGCGGCGCAGATGCCAATGCGGGTGTGAA
TGGCCAAGGCGATACGGTGCCGATGGTATTCCAAACCACTAACCAAGGTGTACTCCCTAACGGCAAGCCC
TCAAAGCTCAATAACTGCACGGTTCTCGGTGCAGCTTACGGGGAAATCTCATCGAGTCGCGGCATTGTGC
GCACCACTCGCCTCAGCTGTATTTTTGAAGATGAAATCATCGACATTCCAGTCGAGGCGACCGTATTTAA
CTATGGCCGCAATGGTATTCGCGGTACTGCCATTATGAAGAACGGCAAAATCGTTCAGATGGCAGGGATT
AGCGGTATTTTGACGGGCATTGGTGAGACAGGTAAAGCACTGAGCCAAACCACATCGAACTCAGCGCTAG
GGTCAACCTCAAGCGTCAATGGCAGTGATGCACTGCTCAACTTAGCCGGCAGTGCCAGTTCAAGCGTGGG
TAGCAAGCTCGCGGATTACTACATCAAATTAGCTGAGCAATACCACCCGATTATTGAGCTCAATCCGGGC
AATACCGTCAACATCGTGTTTTTGAAAGGCTTCCCGCTCGATCCAGTTGGCATTCAAGAATACGAAGAAG
CGCTAGCGCAGCAAGCCCAAAATCCTGTCAGTGCCACAGCGCAAATCCTCAACACGATCAGCAACCCACT
GTTAGAACAGATGCCAGGGAATATTAAGCCGCAGGCCCAAGGCACAAACACGCCTACACCACAGCAGCAA
TATAACCAACAAGGCCAGCGCCCCCCTGTTAACTCAGCCTTTGGCCGTGCGAATTAA
 Primer design