SecReT4
Protein ID: 217980288
T4SS name [ID]Tra_F [529]
Gene symbol-
Locus tagSbal223_4441
StrainShewanella baltica OS223
Repliconplasmid pS22302 [GenBank: NC_011668] [Browse all T4SS(s) in this replicon]
Location [Strand]29154..29969 [-]
Producttype-F conjugative transfer system secretin TraK
Component typeTraK_F
UniProt IDB8EFV6
KEGG IDsbp:Sbal223_4441
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 1.8e-86, Aligned region: 1..263
Protein Sequence: 271 a.a.     [Download]
>gi|217980288|ref|YP_002364264.1| type-F conjugative transfer system secretin TraK [Shewanella baltica OS223]
MKIANPLVFAACALFPMSVLAANTPPKHYGFNDSETVPIELSSVDINRLVVEGDKITSIDCPEGFCVVTG
TKSDKSGAARVNLNLAMPFTAYVSTEKGRHFGLFISPKAIPAVTSIFTAEHYREEQPSVFDKKTPYPTMM
TEFTAQMIRYLATGKPIDGYRVHVVNDDLERTTVDSEPRGTETSIDDAMFTRLNEQMPKPAGLTTEPAFV
FTGKHFNGIIYRVTNHAALPVTLTTAQFYSPTTRAAALSTYELAPQQTGHLFVVSGGESMQ
 
Nucleotide Sequence: 816 bp     [Download]
>gi|217980264|ref|NC_011668.1|:c29969-29154 Shewanella baltica OS223 plasmid pS22302, complete sequence
ATGAAGATTGCTAACCCACTTGTTTTCGCAGCCTGCGCGCTTTTTCCTATGAGCGTGTTAGCGGCAAATA
CGCCCCCAAAACACTACGGATTCAATGACAGTGAAACGGTTCCTATCGAGCTGTCGAGTGTTGATATCAA
CCGCTTAGTCGTTGAAGGTGACAAAATCACCTCGATTGATTGTCCAGAAGGATTTTGCGTTGTCACTGGC
ACTAAATCGGATAAATCCGGTGCAGCGCGCGTCAATCTCAATCTGGCCATGCCATTCACAGCTTATGTAT
CAACTGAAAAGGGCAGACATTTCGGCTTATTCATCAGCCCTAAAGCCATTCCTGCCGTGACCTCTATCTT
CACTGCAGAACATTATCGCGAAGAACAACCCTCCGTTTTCGATAAGAAAACCCCGTACCCAACCATGATG
ACCGAGTTCACCGCGCAAATGATCCGCTACCTCGCCACGGGTAAACCGATTGACGGTTATCGTGTGCATG
TCGTCAATGATGACCTTGAACGCACCACGGTAGACAGTGAGCCGAGAGGCACGGAAACATCTATCGATGA
CGCGATGTTTACTCGCTTAAATGAGCAAATGCCCAAACCTGCAGGACTGACAACAGAACCTGCTTTCGTG
TTCACTGGTAAGCATTTCAACGGCATCATTTATCGCGTAACCAATCACGCAGCACTCCCAGTCACCCTCA
CCACAGCGCAGTTCTACTCACCAACGACGCGAGCCGCAGCCTTATCAACCTATGAATTAGCACCACAACA
AACAGGCCACCTGTTTGTTGTCTCGGGCGGGGAGAGCATGCAATGA
 Primer design