SecReT4
Protein ID: 217980289
T4SS name [ID]Tra_F [529]
Gene symbol-
Locus tagSbal223_4442
StrainShewanella baltica OS223
Repliconplasmid pS22302 [GenBank: NC_011668] [Browse all T4SS(s) in this replicon]
Location [Strand]29969..30535 [-]
Producttype IV conjugative transfer system protein TraE
Component typeTraE_F
UniProt IDB8EFV7
KEGG IDsbp:Sbal223_4442
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1.2e-66, Aligned region: 1..186
Protein Sequence: 188 a.a.     [Download]
>gi|217980289|ref|YP_002364265.1| type IV conjugative transfer system protein TraE [Shewanella baltica OS223]
MLQKNKIDFIRIAKSLNTLLLIGFTVAMISNTVLASIVWKAYFNKSRTVVPPTISAAFTVSDTSIDEPYL
QQMAEYFAFLKLNVTPASVDHQYKQLASYIDEADWHQMQPLLVEDAAMIKKQNISSHFTINETQIALDDR
LVKLTGTLNKYVGKRALEPETISYIIAMNYDHGQLSLKAIKKVQKDVK
 
Nucleotide Sequence: 567 bp     [Download]
>gi|217980264|ref|NC_011668.1|:c30535-29969 Shewanella baltica OS223 plasmid pS22302, complete sequence
ATGTTACAAAAGAACAAGATCGACTTTATTCGCATTGCAAAATCCCTCAACACACTTCTGTTAATCGGCT
TTACCGTAGCCATGATCAGTAACACTGTCCTAGCAAGTATTGTATGGAAGGCCTACTTCAATAAAAGCCG
CACCGTTGTACCACCGACCATCAGCGCAGCCTTTACCGTATCAGACACATCTATAGACGAACCGTATTTA
CAGCAAATGGCCGAATACTTTGCCTTTCTAAAGCTCAATGTCACGCCCGCTTCGGTAGACCATCAGTACA
AACAGCTCGCGAGCTATATCGATGAAGCTGATTGGCATCAGATGCAACCTTTACTGGTTGAAGATGCCGC
CATGATTAAAAAACAAAACATCAGCAGTCACTTCACCATCAATGAAACCCAAATTGCCCTTGATGATCGT
CTCGTCAAACTCACAGGCACGTTAAACAAATATGTGGGCAAACGCGCGCTAGAACCCGAAACCATTAGCT
ACATCATTGCCATGAATTATGACCATGGCCAACTGTCGCTCAAAGCCATTAAGAAAGTGCAAAAGGACGT
TAAATAA
 Primer design