SecReT4
Protein ID: 217980290
T4SS name [ID]Tra_F [529]
Gene symbol-
Locus tagSbal223_4443
StrainShewanella baltica OS223
Repliconplasmid pS22302 [GenBank: NC_011668] [Browse all T4SS(s) in this replicon]
Location [Strand]30576..30878 [-]
Producttype IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDB8EFV8
KEGG IDsbp:Sbal223_4443
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 7.7e-33, Aligned region: 7..99
Protein Sequence: 100 a.a.     [Download]
>gi|217980290|ref|YP_002364266.1| type IV conjugative transfer system protein TraL [Shewanella baltica OS223]
MDNPTQFFSIPKHLNNTPTLLGFAMDELVPALVFFAVLFMMDHALIGMVLASSWFLGMRRMKSQYGMSVL
RLTAYWYAPAEFSASFLKRTPAACRRYWLR
 
Nucleotide Sequence: 303 bp     [Download]
>gi|217980264|ref|NC_011668.1|:c30878-30576 Shewanella baltica OS223 plasmid pS22302, complete sequence
GTGGATAACCCCACTCAGTTTTTTAGCATCCCTAAACACCTCAATAACACCCCTACGCTATTAGGGTTTG
CGATGGATGAACTGGTTCCTGCCTTAGTGTTTTTTGCCGTGTTATTCATGATGGATCACGCGCTCATTGG
CATGGTACTAGCCTCTTCATGGTTTTTAGGGATGCGCAGAATGAAATCGCAATACGGCATGAGCGTATTA
CGCCTCACCGCTTATTGGTACGCCCCAGCAGAATTTAGCGCTTCATTTTTAAAACGAACGCCTGCGGCAT
GTCGCCGCTACTGGTTACGTTAA
 Primer design