SecReT4
Protein ID: 217980291
T4SS name [ID]Tra_F [529]
Gene symbol-
Locus tagSbal223_4444
StrainShewanella baltica OS223
Repliconplasmid pS22302 [GenBank: NC_011668] [Browse all T4SS(s) in this replicon]
Location [Strand]30882..31253 [-]
Producthypothetical protein
Component typeTraA_F
UniProt IDB8EFV9
KEGG IDsbp:Sbal223_4444
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 123 a.a.     [Download]
>gi|217980291|ref|YP_002364267.1| hypothetical protein Sbal223_4444 [Shewanella baltica OS223]
MTTKIQQPNAQQNEVNEEILRLAKHIPSDSTIFIMRCTFLFIICVIATLLLSWDVHAADPFAPAKSEIVD
TVGTGSTAQFAILVVGLCAAALTGFLTKNWGAAIGAFVVGMIFINVALKVVGL
 
Nucleotide Sequence: 372 bp     [Download]
>gi|217980264|ref|NC_011668.1|:c31253-30882 Shewanella baltica OS223 plasmid pS22302, complete sequence
ATGACCACCAAAATCCAACAACCTAACGCCCAACAAAATGAAGTAAACGAAGAAATTCTAAGACTCGCAA
AACATATCCCCAGTGATAGCACCATATTCATAATGCGCTGCACCTTCCTATTCATCATTTGTGTCATCGC
TACTTTGCTGTTGTCTTGGGATGTACATGCTGCAGATCCTTTTGCACCGGCTAAATCTGAAATTGTTGAT
ACCGTTGGCACCGGCTCAACTGCACAGTTCGCCATTCTCGTCGTGGGTTTATGTGCCGCTGCACTTACCG
GCTTTTTAACCAAAAACTGGGGCGCAGCTATTGGGGCTTTTGTCGTTGGTATGATCTTCATCAACGTGGC
CTTAAAGGTTGTAGGTCTATAG
 Primer design