SecReT4
Protein ID: 217980292
T4SS name [ID]Tra_F [529]
Gene symbol-
Locus tagSbal223_4445
StrainShewanella baltica OS223
Repliconplasmid pS22302 [GenBank: NC_011668] [Browse all T4SS(s) in this replicon]
Location [Strand]31308..31586 [-]
Producthypothetical protein
Component typeTraY_F
UniProt IDB8EFW0
KEGG IDsbp:Sbal223_4445
PDB IDNA
Domain hit(s) vs Pfam TraY [PF05509], Evalue: 5.7e-21, Aligned region: 41..83
Protein Sequence: 92 a.a.     [Download]
>gi|217980292|ref|YP_002364268.1| hypothetical protein Sbal223_4445 [Shewanella baltica OS223]
MVKWFTPGGYFVYFCFPLLYYPSHDHPYSNYLSFMTKPTHVNVVLDGKTNEMLEASAKRNNRSKRKEAQA
RLIDHLSRFDEMGMGLKGKDKS
 
Nucleotide Sequence: 279 bp     [Download]
>gi|217980264|ref|NC_011668.1|:c31586-31308 Shewanella baltica OS223 plasmid pS22302, complete sequence
ATGGTTAAATGGTTTACCCCTGGTGGTTATTTTGTTTACTTTTGTTTTCCGCTGCTTTATTATCCATCCC
ATGATCATCCATACAGTAATTATCTCTCTTTCATGACCAAGCCGACGCATGTCAATGTCGTTTTAGACGG
CAAAACAAACGAAATGTTAGAAGCCTCGGCCAAACGTAACAATCGCTCTAAGCGCAAAGAGGCTCAAGCA
CGACTCATTGACCACCTTAGCCGCTTCGATGAGATGGGAATGGGTCTAAAAGGAAAAGATAAGTCTTAA
 Primer design