SecReT4
Protein ID: 218454981
T4SS name [ID]VirB [462]
Gene symbol-
Locus tagp2ECUMN_0022
StrainEscherichia coli UMN026
Repliconplasmid p2ESCUM [GenBank: NC_011739] [Browse all T4SS(s) in this replicon]
Location [Strand]13264..15105 [-]
ProductHypothetical protein, putative TraG/TraD family protein, putative membrane protein
Component typeVirD4
UniProt IDB7LJC2
KEGG IDeum:p2ECUMN_0022
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 9.7e-143, Aligned region: 104..573
TraG-D_C [PF12696], Evalue: 4.8e-25, Aligned region: 418..536
TrwB_AAD_bind [PF10412], Evalue: 1e-18, Aligned region: 333..550
Protein Sequence: 613 a.a.     [Download]
>gi|218454981|ref|YP_002381204.1| Hypothetical protein, putative TraG/TraD family protein, putative membrane protein [Escherichia coli UMN026]
MIMSLKLPDKGQWVFIGLVMCLVTYYAGSVAVYFLNGKTPLYIWKNFDSMLLWKIITESNIRTDIRLTAI
PSLLSGMVSSLIVPVFVIWQLNKMDVALYGDAKFASDNDLKKSKLLKWETENDTDILVGAYKGKYLWYTA
PDFVSLGAGTRAGKGAAIGIPNLLVRKHSLIALDPKQELWKITSKVREILLGNKVYLLDPFNSKTHQFNP
LFYIDLKAESGAKDLLKLIEILFPSYGMTGAEAHFNNLAGQYWTGLAKLLHFFINYEPSWLNEFGLKPVF
SIGSVVDLYSNIDRELILSKREELEGTNGLDENALYHLRDALTKIREYHETEDEQRSSIDGSFRKKMSLF
YLPTVRKCTDGNDFDLRQLRREDITVYVGVNAEDISLAYDFLNLFFNFVVEVTLRENPDFDPTLKHDCLM
FLDEFPSIGYMPIIKKGSGYIAGFKLKLLTIYQNISQLNEIYGIEGAKTLMSAHPCRIIYAVSEEDDAAK
ISEKLGYITTTSKSTSKSRGRSASQGESESEARRALVLPQELGTLDFKEEFIILKGENPVKAEKALYYLD
PYFMDRLMKVSPKLASLTMELNKTKKIFGVKGLKYPSKEKMLSVGELESEVLL
 
Nucleotide Sequence: 1842 bp     [Download]
>ref|NC_011739.1|:c15105-13264 Hypothetical protein, putative TraG/TraD family protein, putative membrane protein [Escherichia coli UMN026]
GTGATTATGTCTTTAAAACTTCCAGATAAAGGCCAGTGGGTTTTTATCGGTCTGGTTATGTGTCTCGTGA
CCTATTATGCTGGTTCTGTTGCTGTTTATTTCCTGAACGGAAAAACACCACTGTATATATGGAAAAATTT
TGATTCCATGTTGCTCTGGAAAATAATAACAGAGAGTAATATACGTACAGATATCAGACTGACTGCCATA
CCTTCTCTTTTGTCAGGTATGGTTTCGTCTCTCATTGTGCCTGTTTTTGTTATCTGGCAACTGAATAAAA
TGGATGTTGCTCTTTATGGTGATGCGAAGTTTGCCAGTGACAATGATTTAAAAAAATCAAAACTGCTTAA
GTGGGAGACAGAAAATGATACGGATATTCTGGTCGGCGCGTATAAAGGAAAATATCTGTGGTATACCGCC
CCGGATTTTGTATCTCTTGGTGCAGGAACCCGCGCCGGTAAAGGTGCCGCCATTGGTATCCCTAATCTTC
TGGTCAGAAAACACTCTCTGATTGCGTTAGATCCAAAACAGGAATTGTGGAAAATCACCAGTAAGGTGCG
TGAAATACTGCTGGGTAATAAAGTTTACCTTCTCGACCCATTCAACAGTAAGACACACCAGTTTAACCCC
CTTTTCTATATTGATTTAAAAGCGGAGAGTGGGGCTAAGGATCTGCTTAAACTGATTGAAATTCTGTTTC
CATCTTATGGCATGACAGGGGCAGAAGCGCACTTTAATAATCTTGCGGGTCAATACTGGACAGGACTGGC
TAAGTTGCTTCATTTCTTTATTAACTATGAGCCGTCCTGGCTTAATGAGTTCGGGCTTAAACCCGTTTTC
TCAATCGGTTCTGTCGTCGACCTGTACAGCAATATTGACCGGGAACTGATACTCAGTAAGCGGGAAGAAC
TGGAGGGAACAAACGGACTTGATGAAAACGCGTTGTATCATTTGCGCGATGCCCTGACCAAAATCAGGGA
ATATCACGAAACGGAAGATGAACAGCGTTCAAGCATTGATGGTTCTTTCCGTAAGAAAATGAGCCTGTTT
TATCTCCCAACCGTTCGTAAATGTACTGATGGTAATGATTTCGATCTCCGTCAGTTGCGACGGGAAGATA
TCACTGTTTATGTCGGTGTTAATGCGGAAGATATATCTCTGGCTTACGATTTTCTGAACCTGTTTTTCAA
CTTCGTTGTTGAAGTGACATTGCGTGAAAATCCTGATTTTGATCCCACCCTGAAACATGACTGCCTGATG
TTTCTTGATGAGTTCCCTTCGATTGGTTATATGCCAATTATTAAAAAGGGGTCAGGGTATATTGCAGGTT
TTAAACTTAAACTGCTGACGATTTATCAGAATATCAGTCAGCTAAATGAAATCTATGGTATTGAGGGAGC
CAAAACGCTGATGAGTGCTCATCCATGCCGTATTATCTATGCTGTCAGCGAAGAGGATGATGCCGCGAAG
ATATCAGAAAAACTTGGGTATATTACAACCACATCAAAGAGCACAAGCAAGAGCCGGGGACGATCAGCTT
CACAGGGCGAATCAGAAAGTGAAGCCCGAAGAGCACTGGTGCTTCCACAGGAGCTGGGAACGCTGGACTT
TAAAGAAGAATTTATCATCCTGAAGGGGGAGAACCCTGTTAAAGCAGAAAAGGCACTTTATTACCTTGAT
CCGTATTTTATGGACAGGTTAATGAAGGTCAGTCCTAAACTGGCATCATTGACGATGGAACTAAATAAGA
CGAAAAAAATATTTGGTGTGAAAGGGCTTAAATATCCGTCAAAAGAAAAAATGCTCTCCGTAGGGGAGCT
GGAGTCTGAGGTTTTGCTATGA
 Primer design