SecReT4
Protein ID: 218454982
T4SS name [ID]VirB [462]
Gene symbol-
Locus tagp2ECUMN_0023
StrainEscherichia coli UMN026
Repliconplasmid p2ESCUM [GenBank: NC_011739] [Browse all T4SS(s) in this replicon]
Location [Strand]15102..16133 [-]
ProductPutative protein virB11, putative Type II/IV secretion system protein
Component typeVirB11
UniProt IDB7LJC3
KEGG IDeum:p2ECUMN_0023
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.6e-50, Aligned region: 25..311
Protein Sequence: 343 a.a.     [Download]
>gi|218454982|ref|YP_002381205.1| Putative protein virB11, putative Type II/IV secretion system protein [Escherichia coli UMN026]
MNNENRHLIYDVVNDYFYHWLNEIDGVTEIAVNRPGEIFIKVRGKWQWYEQKMSYSDCLSFASTLADFHD
GGSVTPEYPLRSATLPGGERVQVVIPPATEKDTVSITIRKPSGIFISHDKFIKQGFYSRVSGLSGDSVME
DNISALITSGYFERVIPESLSQGKTIVFCGGTGSGKTTFANACLEYIPHHLRCISIEDTDEAKFRFHKNH
VKLYYPAEGESKIITSASLLRSCFRMNPDRILMTEIRGAEAWDFLKASSSGHAGNITTVHESSPEYAVLG
IVQRCYMNPECQNLPFNVILRRVLSNIDIIMSIKYLDDEDFRFASGIYYRQLHFDDYFRKLKE
 
Nucleotide Sequence: 1032 bp     [Download]
>ref|NC_011739.1|:c16133-15102 Putative protein virB11, putative Type II/IV secretion system protein [Escherichia coli UMN026]
GTGAATAACGAAAACAGACATCTGATTTATGATGTGGTTAACGACTATTTTTATCACTGGCTGAATGAGA
TTGATGGTGTCACGGAAATCGCTGTTAACCGACCAGGAGAAATATTTATAAAGGTCAGGGGAAAGTGGCA
ATGGTATGAACAAAAGATGAGTTACAGTGATTGTCTTTCTTTTGCATCCACACTGGCCGATTTTCATGAC
GGCGGTTCTGTGACTCCTGAATATCCCCTGCGTTCTGCCACGCTTCCGGGTGGAGAACGTGTTCAGGTTG
TGATCCCACCGGCAACTGAAAAAGATACTGTTTCTATAACAATCCGTAAGCCGTCAGGTATTTTTATCAG
TCATGACAAATTTATAAAACAGGGATTTTATTCACGCGTCAGTGGTTTAAGTGGTGACTCTGTTATGGAA
GATAATATTTCTGCTTTAATCACTTCCGGATATTTTGAAAGGGTTATACCTGAATCACTGAGTCAGGGGA
AAACGATAGTTTTCTGTGGAGGAACAGGGTCAGGTAAAACCACCTTTGCAAATGCCTGTCTGGAATATAT
ACCGCATCATCTGCGGTGTATTTCTATTGAAGATACTGATGAGGCAAAATTCAGATTTCACAAAAACCAT
GTAAAACTTTACTATCCGGCAGAGGGGGAGAGTAAGATTATTACCTCAGCGAGTCTTCTGCGTTCCTGTT
TTCGTATGAATCCGGACAGGATTCTGATGACAGAAATCAGGGGAGCTGAGGCATGGGATTTTCTGAAAGC
ATCGAGTTCAGGCCATGCAGGAAACATTACCACCGTTCACGAAAGTAGTCCTGAATATGCCGTGCTTGGG
ATTGTCCAGCGATGTTATATGAATCCTGAATGTCAGAATCTACCATTCAATGTCATTTTAAGACGTGTAC
TGAGTAATATTGATATTATCATGAGTATTAAATACCTTGATGATGAAGATTTTCGGTTCGCTTCCGGCAT
TTACTACAGACAACTTCATTTTGATGATTATTTCAGAAAACTGAAGGAGTGA
 Primer design