SecReT4
Protein ID: 218454985
T4SS name [ID]VirB [462]
Gene symbol-
Locus tagp2ECUMN_0026
StrainEscherichia coli UMN026
Repliconplasmid p2ESCUM [GenBank: NC_011739] [Browse all T4SS(s) in this replicon]
Location [Strand]18271..18984 [-]
ProductPutative pilx8 protein
Component typeVirB8
UniProt IDB7LJC6
KEGG IDeum:p2ECUMN_0026
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2e-47, Aligned region: 19..234
Protein Sequence: 237 a.a.     [Download]
>gi|218454985|ref|YP_002381208.1| Putative pilx8 protein [Escherichia coli UMN026]
MEFKLPGFKNKKDVTDSSVSFEEKNIALQERMNRIYKFGGIGGMLIGGLSLLALNAALPLKTTVVDAYLI
DKVTGVAERLTSVKKENLSENEAIARYFITQYIKHREGYNFFSLQHDYDYVMAYSAENVAADYNALFNSE
QAPKLVYNKAEKTAMVQDNPSVIISPSSRTDDKDIGAYIRFRLTIRDVATGQTRQEFWNVRLTYRIEPQV
EMVSGERNNNPLKFVVTSYVRDKEARG
 
Nucleotide Sequence: 714 bp     [Download]
>ref|NC_011739.1|:c18984-18271 Putative pilx8 protein [Escherichia coli UMN026]
ATGGAATTTAAACTTCCCGGATTTAAAAATAAAAAAGACGTTACTGACTCATCAGTTTCGTTTGAAGAAA
AAAACATTGCACTACAGGAGAGAATGAATCGTATTTATAAATTCGGTGGTATCGGAGGCATGTTAATTGG
TGGGCTGTCTTTACTTGCATTAAATGCAGCATTACCACTGAAAACAACAGTTGTTGATGCCTACCTTATC
GATAAGGTTACAGGTGTGGCTGAACGTCTGACTTCTGTTAAAAAAGAAAATCTTTCTGAAAACGAAGCCA
TTGCCCGATATTTTATCACCCAGTATATAAAACATCGTGAAGGTTATAATTTTTTCAGTCTCCAGCATGA
TTATGATTATGTAATGGCTTACAGCGCGGAGAATGTCGCGGCAGATTATAACGCATTATTTAACAGTGAA
CAGGCACCAAAACTTGTTTATAACAAAGCAGAAAAAACGGCAATGGTTCAGGATAATCCATCTGTCATAA
TTTCACCTTCGTCACGGACGGATGATAAAGATATCGGTGCGTATATTCGTTTTCGTCTGACCATCAGGGA
TGTTGCTACCGGACAAACCCGCCAGGAGTTCTGGAATGTTCGCCTGACTTATCGTATCGAACCGCAGGTT
GAAATGGTGTCAGGGGAACGTAATAACAATCCTCTTAAGTTCGTTGTAACAAGCTACGTTCGCGATAAAG
AAGCCAGAGGTTAA
 Primer design