SecReT4
Protein ID: 218534532
T4SS name [ID]Tra_F [89]
Gene symbolyubQ
Locus tagpECS88_0062
StrainEscherichia coli S88
Repliconplasmid pECOS88 [GenBank: NC_011747] [Browse all T4SS(s) in this replicon]
Location [Strand]48716..49225 [-]
Productlytic transglycosylase
Component typeOrf169_F
UniProt IDB7LI61
KEGG IDecz:pECS88_0062
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 169 a.a.     [Download]
>gi|218534532|ref|YP_002401062.1| lytic transglycosylase [Escherichia coli S88]
MKKWMLAICLMFINEICLATDCFDLAGRDYKIDPDLLRAISWQESRYRVNAIGINPVTGYGSGLMQVDSQ
HFNELARYGIKPEHMTTDPCMNIYTGAYYLAIAFKKWGVTWEAVGAYNAGFRKTERQNQRRLAYASDVYR
IYTGIKSSKGIRVPTTKKSLSQMNSVQNN
 
Nucleotide Sequence: 510 bp     [Download]
>gi|218534477|ref|NC_011747.1|:c49225-48716 Escherichia coli S88 plasmid pECOS88, complete sequence
ATGAAAAAATGGATGTTAGCCATCTGCCTGATGTTTATAAATGAGATCTGTCTGGCCACTGATTGCTTTG
ATCTTGCAGGCAGGGATTACAAAATAGATCCTGATTTACTGAGAGCAATATCATGGCAAGAATCCCGTTA
CCGGGTTAATGCCATCGGTATTAATCCGGTAACGGGATATGGCAGCGGACTGATGCAGGTAGATTCCCAG
CATTTTAACGAACTGGCCCGCTACGGAATTAAGCCGGAACATATGACAACAGATCCCTGCATGAACATTT
ATACCGGTGCTTATTATCTGGCAATAGCATTTAAAAAATGGGGCGTCACCTGGGAGGCCGTTGGTGCATA
CAATGCCGGATTCAGGAAAACCGAACGCCAGAACCAGAGGCGTCTTGCCTACGCATCAGATGTTTACCGG
ATTTATACCGGGATAAAAAGCAGTAAAGGTATCCGGGTTCCGACCACGAAGAAATCACTTTCCCAAATGA
ACAGTGTGCAGAACAATTAA
 Primer design