SecReT4
Protein ID: 218534533
T4SS name [ID]Tra_F [89]
Gene symboltraM
Locus tagpECS88_0063
StrainEscherichia coli S88
Repliconplasmid pECOS88 [GenBank: NC_011747] [Browse all T4SS(s) in this replicon]
Location [Strand]49640..50023 [+]
Productconjugal transfer protein TraM
Component typeTraM_F
UniProt IDB7LI62
KEGG IDecz:pECS88_0063
PDB IDNA
Domain hit(s) vs Pfam Tra_M [PF05261], Evalue: 1e-59, Aligned region: 1..127
Protein Sequence: 127 a.a.     [Download]
>gi|218534533|ref|YP_002401063.1| conjugal transfer protein TraM [Escherichia coli S88]
MAKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQMERKESAFNQTEFNKLL
LECVVKTQSSVAKILGIESLSPHVSGNPKFEYANMVEDIREKVSSEMERFFPKNDDE
 
Nucleotide Sequence: 384 bp     [Download]
>gi|218534477|ref|NC_011747.1|:49640-50023 Escherichia coli S88 plasmid pECOS88, complete sequence
ATGGCTAAGGTGAACCTGTATATCAGCAATGATGCCTATGAAAAAATAAATGCGATTATTGAGAAGCGTC
GACAGGAAGGGGCAAGGGAAAAAGATGTCAGTTTTTCAGCAACAGCTTCAATGCTTCTTGAACTGGGGCT
TCGTGTACATGAGGCTCAGATGGAGCGTAAAGAGTCTGCATTTAATCAGACTGAGTTTAATAAATTGCTT
CTTGAATGCGTTGTAAAAACACAATCATCAGTAGCGAAAATTTTGGGTATTGAGTCTCTCAGTCCTCATG
TCTCCGGAAATCCAAAGTTTGAATATGCCAATATGGTTGAAGATATCAGGGAGAAGGTATCATCTGAGAT
GGAACGATTTTTTCCAAAAAATGATGATGAATAA
 Primer design