SecReT4
Protein ID: 218534535
T4SS name [ID]Tra_F [89]
Gene symboltraY
Locus tagpECS88_0065
StrainEscherichia coli S88
Repliconplasmid pECOS88 [GenBank: NC_011747] [Browse all T4SS(s) in this replicon]
Location [Strand]50992..51393 [+]
Productconjugal transfer protein TraY
Component typeTraY_F
UniProt IDB7LI64
KEGG IDecz:pECS88_0065
PDB IDNA
Domain hit(s) vs Pfam TraY [PF05509], Evalue: 4.5e-38, Aligned region: 17..60
TraY [PF05509], Evalue: 4.5e-38, Aligned region: 72..119
Protein Sequence: 133 a.a.     [Download]
>gi|218534535|ref|YP_002401065.1| conjugal transfer protein TraY [Escherichia coli S88]
MLLKRFGTRSATGKMVKLKLPVDVESLLIEASNRSGRSRSFEAVIRLKDHLHRYPKFNRAGNIYGKSLVK
YLTMRLDDETNQLLIAAKNRSGWCKTDEAADRVIDHLIKFPDFYNSEIFREADKEEDITFNTL
 
Nucleotide Sequence: 402 bp     [Download]
>gi|218534477|ref|NC_011747.1|:50992-51393 Escherichia coli S88 plasmid pECOS88, complete sequence
GTGTTATTGAAAAGATTTGGTACACGTTCTGCAACAGGTAAGATGGTAAAACTAAAATTACCTGTAGATG
TGGAAAGTCTATTAATTGAGGCAAGTAACAGAAGCGGAAGAAGTCGATCGTTTGAGGCAGTAATAAGACT
TAAAGATCATCTTCACCGCTATCCAAAGTTTAACAGGGCAGGGAATATCTATGGTAAGTCGCTGGTTAAG
TATCTGACAATGCGTCTGGATGATGAAACTAACCAGCTACTTATTGCAGCCAAAAATCGTAGTGGATGGT
GTAAAACAGATGAGGCTGCAGACAGAGTTATTGATCATTTGATCAAGTTTCCTGATTTTTATAACTCGGA
GATATTCAGGGAGGCAGATAAAGAGGAAGATATAACATTTAATACACTCTAG
 Primer design