SecReT4
Protein ID: 218534536
T4SS name [ID]Tra_F [89]
Gene symboltraA
Locus tagpECS88_0066
StrainEscherichia coli S88
Repliconplasmid pECOS88 [GenBank: NC_011747] [Browse all T4SS(s) in this replicon]
Location [Strand]51426..51791 [+]
Productconjugal transfer pilin subunit TraA
Component typeTraA_F
UniProt IDB7LI65
KEGG IDecz:pECS88_0066
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 1.9e-59, Aligned region: 1..120
Protein Sequence: 121 a.a.     [Download]
>gi|218534536|ref|YP_002401066.1| conjugal transfer pilin subunit TraA [Escherichia coli S88]
MNAVLSVQGASAPVKKKSFFSKFTRLNMLRLARAVIPAAVLMMFFPQLAMAAGSSGQDLMASGNTTVKAT
FGKDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAGFAIISVFIAVGMAVVGL
 
Nucleotide Sequence: 366 bp     [Download]
>gi|218534477|ref|NC_011747.1|:51426-51791 Escherichia coli S88 plasmid pECOS88, complete sequence
ATGAATGCTGTTTTAAGTGTTCAGGGTGCTTCTGCGCCCGTCAAAAAGAAGTCGTTTTTTTCCAAATTCA
CTCGTCTGAATATGCTTCGCCTGGCTCGCGCAGTGATCCCGGCTGCTGTTCTGATGATGTTCTTCCCGCA
GCTGGCGATGGCCGCCGGCAGCAGTGGTCAGGACCTGATGGCAAGCGGTAACACCACGGTTAAGGCGACC
TTCGGTAAGGACTCCAGTGTTGTTAAATGGGTTGTTCTGGCTGAAGTTCTGGTCGGTGCTGTCATGTACA
TGATGACCAAAAACGTCAAGTTCCTAGCCGGTTTTGCCATCATCTCTGTATTTATTGCTGTGGGTATGGC
CGTCGTTGGCCTCTGA
 Primer design