SecReT4
Protein ID: 218534538
T4SS name [ID]Tra_F [89]
Gene symboltraE
Locus tagpECS88_0068
StrainEscherichia coli S88
Repliconplasmid pECOS88 [GenBank: NC_011747] [Browse all T4SS(s) in this replicon]
Location [Strand]52139..52705 [+]
Productconjugal transfer pilus assembly protein TraE
Component typeTraE_F
UniProt IDB7LI67
KEGG IDecz:pECS88_0068
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1.4e-73, Aligned region: 1..187
Protein Sequence: 188 a.a.     [Download]
>gi|218534538|ref|YP_002401068.1| conjugal transfer pilus assembly protein TraE [Escherichia coli S88]
MEHGARLSTSRVMAIAFIFMSVLIVLSLSVNVIQGMNNYRLQNEQRTAVTPMAFNAPFAVSQNSADASYL
QQMALSFIALRLNVSSETVDASHQALLQYIRPGAQNQMKVILAEEAKRIKNDNVNSAFFQTSVRVWPQYG
RVEIRGVLKTWIGDSKPFTDIKHYILILKRENGVTWLDNFGETDDEKK
 
Nucleotide Sequence: 567 bp     [Download]
>gi|218534477|ref|NC_011747.1|:52139-52705 Escherichia coli S88 plasmid pECOS88, complete sequence
ATGGAACACGGTGCCCGTTTAAGTACCAGTCGTGTAATGGCCATCGCCTTTATATTTATGTCAGTGCTTA
TTGTTCTCAGCCTCTCTGTTAACGTCATTCAGGGGATGAATAACTACCGTCTTCAGAATGAGCAACGCAC
TGCCGTGACGCCAATGGCATTTAATGCCCCCTTTGCCGTGTCACAGAACAGTGCCGACGCCTCTTATTTA
CAGCAGATGGCGCTGTCATTTATTGCCCTCCGTCTGAATGTTTCATCAGAAACCGTCGATGCCTCACATC
AGGCGCTTCTGCAATATATCCGCCCGGGCGCACAGAACCAGATGAAAGTTATTCTGGCTGAAGAAGCGAA
GCGTATTAAAAACGATAACGTGAACTCAGCCTTTTTCCAGACCAGTGTTCGTGTCTGGCCTCAGTATGGC
CGTGTGGAAATTCGAGGTGTGCTTAAAACCTGGATTGGTGATTCAAAACCTTTCACTGATATCAAACATT
ACATCCTTATTCTGAAGCGGGAAAACGGGGTGACCTGGCTGGATAATTTCGGGGAAACAGACGATGAGAA
AAAATAA
 Primer design