SecReT4
Protein ID: 218534539
T4SS name [ID]Tra_F [89]
Gene symboltraK
Locus tagpECS88_0069
StrainEscherichia coli S88
Repliconplasmid pECOS88 [GenBank: NC_011747] [Browse all T4SS(s) in this replicon]
Location [Strand]52692..53420 [+]
Productconjugal transfer protein TraK
Component typeTraK_F
UniProt IDB7LI68
KEGG IDecz:pECS88_0069
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 4.3e-70, Aligned region: 12..235
Protein Sequence: 242 a.a.     [Download]
>gi|218534539|ref|YP_002401069.1| conjugal transfer protein TraK [Escherichia coli S88]
MRKNNTAIIFGSLFFSCSVMAANGTLAPTVVPMVNGGQASIAISNTSPNLFTVPGDRIIAVNSLDGALTN
NEQTASGGVVVATVNKKPFTFILETERGLNLSIQAVPREGAGRTIQLVSDLRGTGEEAGAWETSTPYESL
LVTISQAVRGGKLPAGWYQVPVTKETLQAPAGLSSVADAVWTGNHLKMVRFAVENKTLSALNIRESDFWQ
PGTRAVMFSQPASQLLAGARMDVYVIRDGEGN
 
Nucleotide Sequence: 729 bp     [Download]
>gi|218534477|ref|NC_011747.1|:52692-53420 Escherichia coli S88 plasmid pECOS88, complete sequence
ATGAGAAAAAATAATACGGCAATAATATTCGGCAGCCTGTTTTTTTCCTGCAGCGTGATGGCCGCAAACG
GTACGCTGGCCCCCACCGTGGTGCCAATGGTGAACGGTGGTCAGGCCAGTATTGCCATCAGCAATACCAG
CCCGAATCTGTTTACCGTTCCCGGTGATCGGATTATCGCCGTGAACAGTCTGGATGGTGCCCTGACCAAT
AATGAGCAGACCGCCTCCGGCGGTGTGGTGGTTGCCACCGTCAACAAAAAGCCCTTTACGTTCATTCTGG
AAACAGAACGTGGTCTGAATCTTTCCATTCAGGCCGTTCCCCGTGAAGGCGCGGGGCGTACCATTCAGCT
GGTCAGTGACCTGCGCGGAACCGGAGAAGAAGCCGGTGCGTGGGAAACGTCCACGCCTTACGAATCCCTG
CTTGTGACCATCAGCCAGGCCGTCCGTGGCGGAAAATTACCCGCAGGCTGGTATCAGGTCCCAGTGACAA
AGGAAACCCTGCAGGCCCCGGCGGGGCTGTCTTCAGTGGCAGATGCCGTATGGACGGGGAATCACCTGAA
GATGGTCCGCTTTGCCGTGGAAAATAAAACGCTGTCTGCCCTGAATATCCGGGAAAGTGACTTCTGGCAG
CCGGGAACCCGTGCCGTGATGTTCAGCCAGCCTGCCAGCCAGTTACTGGCAGGTGCGCGCATGGATGTGT
ATGTCATCCGTGACGGGGAGGGCAACTGA
 Primer design