SecReT4
Protein ID: 218534540
T4SS name [ID]Tra_F [89]
Gene symboltraB
Locus tagpECS88_0070
StrainEscherichia coli S88
Repliconplasmid pECOS88 [GenBank: NC_011747] [Browse all T4SS(s) in this replicon]
Location [Strand]53420..54847 [+]
Productconjugal transfer pilus assembly protein TraB
Component typeTraB_F
UniProt IDB7LI69
KEGG IDecz:pECS88_0070
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.9e-40, Aligned region: 213..409
CALCOCO1 [PF07888], Evalue: 4.6e-05, Aligned region: 68..121
Protein Sequence: 475 a.a.     [Download]
>gi|218534540|ref|YP_002401070.1| conjugal transfer pilus assembly protein TraB [Escherichia coli S88]
MASINTIVKRKQYLWLGIVVVGTASAIGGALYLSDVDMSGNGETVAEQEPVPDMTGVVDTTFDDKVRQHA
TTEMQVTAAQMQKQYEEIRRELDVLNKQRGDDQRRIEKLGQDNAALAEQVKALGANPVTATGEPVPQMPA
SPPGPEGEPQPGNTPVSFPPQGSVAVPPPTAFYPGNGVTPPPQVTYQSVPVPNRIQRKVFTRNEGKQGPS
LPYIPSGSFAKAMLIEGADANASVTGNESTVPMQLRITGLVEMPNSKTYDATGCFVGLEAWGDVSSERAI
VRTRNISCLKDGKTIDMPIKGHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDGIGQGMERASQPAVGLG
ATAAYGAGDVLKMGIGGGASKAAQTLSDYYIKRAEQYHPVIPIGAGNEVTVVFQDGFQLKTVEEMALERT
QSRAEEDNPESPVPVPPSAESHLNGFNTDQMLKQLGNLNPQQFMSGSQGGGNDGK
 
Nucleotide Sequence: 1428 bp     [Download]
>gi|218534477|ref|NC_011747.1|:53420-54847 Escherichia coli S88 plasmid pECOS88, complete sequence
ATGGCCAGTATCAATACCATTGTGAAACGCAAGCAGTACCTGTGGCTGGGGATTGTGGTTGTCGGTACAG
CCTCCGCGATTGGTGGGGCACTGTATCTGTCTGATGTGGACATGTCCGGTAACGGTGAAACCGTGGCTGA
ACAGGAGCCTGTGCCGGATATGACCGGTGTGGTGGATACGACCTTTGATGACAAGGTGCGTCAGCATGCC
ACCACCGAGATGCAGGTGACGGCAGCGCAGATGCAGAAGCAGTATGAGGAAATCCGTCGTGAGCTGGATG
TTCTGAACAAACAGCGCGGTGATGACCAGCGTCGTATTGAAAAGTTGGGACAGGACAATGCCGCCCTGGC
AGAGCAGGTAAAAGCCCTGGGTGCTAATCCCGTCACGGCGACCGGTGAGCCTGTACCGCAGATGCCTGCC
TCACCGCCCGGCCCGGAAGGCGAACCACAGCCAGGAAACACCCCCGTATCCTTCCCGCCGCAGGGCAGCG
TTGCTGTTCCACCGCCGACGGCGTTTTATCCCGGGAATGGTGTCACGCCACCACCACAGGTGACGTACCA
GTCTGTGCCGGTGCCTAACCGGATACAGCGTAAGGTGTTTACCCGTAATGAGGGAAAACAGGGACCATCA
CTGCCGTACATTCCGTCAGGAAGTTTTGCGAAAGCCATGCTGATTGAAGGGGCGGATGCCAATGCCTCTG
TCACCGGTAATGAATCCACGGTGCCGATGCAGCTGCGTATCACCGGCCTGGTGGAAATGCCGAACAGCAA
GACGTATGACGCAACGGGATGTTTTGTGGGTCTGGAAGCCTGGGGGGATGTGTCCAGTGAGCGTGCCATT
GTACGCACCCGCAATATCAGTTGCCTGAAGGACGGCAAAACTATTGATATGCCGATTAAGGGGCATGTCA
GCTTCCGGGGTAAAAACGGTATCAAGGGCGAAGTGGTGATGCGTAACGGCAAAATCCTCGGCTGGGCATG
GGGCGCGGGATTTGTTGACGGTATTGGTCAGGGAATGGAGCGCGCCTCCCAGCCGGCTGTCGGGCTGGGT
GCCACAGCCGCTTACGGGGCTGGTGATGTCCTGAAAATGGGTATCGGTGGCGGCGCATCGAAAGCCGCAC
AGACGCTCAGTGACTACTACATCAAACGTGCCGAACAGTATCACCCGGTGATACCGATTGGTGCGGGCAA
CGAAGTGACCGTGGTGTTCCAGGACGGCTTCCAGCTGAAAACCGTGGAAGAGATGGCGCTGGAACGCACG
CAGAGCAGAGCGGAAGAAGACAATCCGGAAAGTCCGGTTCCTGTTCCGCCATCGGCTGAAAGTCATCTTA
ACGGCTTTAATACTGACCAGATGCTGAAGCAGCTGGGCAACCTGAATCCGCAGCAGTTTATGTCCGGCAG
CCAGGGAGGGGGCAACGATGGCAAATAA
 Primer design