SecReT4
Protein ID: 218534544
T4SS name [ID]Tra_F [89]
Gene symboltraV
Locus tagpECS88_0074
StrainEscherichia coli S88
Repliconplasmid pECOS88 [GenBank: NC_011747] [Browse all T4SS(s) in this replicon]
Location [Strand]55871..56386 [+]
Productconjugal transfer protein TraV
Component typeTraV_F
UniProt IDB7LI73
KEGG IDecz:pECS88_0074
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 7.1e-40, Aligned region: 23..165
Protein Sequence: 171 a.a.     [Download]
>gi|218534544|ref|YP_002401074.1| conjugal transfer protein TraV [Escherichia coli S88]
MKQISFFIPLLGTLLLSGCAGTSTEFECNATTSDTCMTMEQANEKAKKLERSSEAKPVAASLPRLAEGNF
RTMPVQTVTATTPSGSRPAVTAHPEQKLLAPRPLFTAAREVKTVVPVSSVTPVTPPRPLRTGEQTAALWI
APYIDNQDVYHQPSSVFFVIKPSAWGKPRIN
 
Nucleotide Sequence: 516 bp     [Download]
>gi|218534477|ref|NC_011747.1|:55871-56386 Escherichia coli S88 plasmid pECOS88, complete sequence
ATGAAACAGATTTCTTTCTTTATTCCTCTGCTGGGGACCTTATTACTTTCCGGCTGTGCCGGAACCAGTA
CGGAATTTGAGTGTAACGCCACCACATCCGATACCTGTATGACGATGGAGCAGGCCAATGAGAAGGCCAA
AAAACTGGAGCGGTCCTCAGAAGCAAAGCCGGTTGCGGCATCACTGCCGCGCCTGGCTGAAGGGAACTTC
CGGACAATGCCGGTGCAGACCGTCACCGCGACCACTCCGTCCGGCAGCAGACCTGCGGTGACAGCACATC
CGGAGCAGAAACTGCTGGCACCTCGCCCGCTGTTTACCGCTGCCCGGGAAGTGAAAACGGTTGTTCCGGT
CAGTTCAGTTACGCCGGTAACACCTCCTCGTCCGCTAAGAACGGGTGAGCAGACGGCAGCATTATGGATA
GCGCCTTATATTGATAACCAGGATGTTTATCATCAGCCATCCAGCGTGTTTTTTGTTATTAAACCGTCTG
CGTGGGGAAAACCACGTATTAATTAA
 Primer design