SecReT4
Protein ID: 218534546
T4SS name [ID]Tra_F [89]
Gene symboltraC
Locus tagpECS88_0077
StrainEscherichia coli S88
Repliconplasmid pECOS88 [GenBank: NC_011747] [Browse all T4SS(s) in this replicon]
Location [Strand]56902..59529 [+]
Productconjugal transfer ATP-binding protein TraC
Component typeTraC_F
UniProt IDB7LI75
KEGG IDecz:pECS88_0077
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 4.5e-59, Aligned region: 37..277
AAA_10 [PF12846], Evalue: 1.7e-43, Aligned region: 479..772
DUF87 [PF01935], Evalue: 1.6e-05, Aligned region: 482..669
TrwB_AAD_bind [PF10412], Evalue: 5.5e-05, Aligned region: 479..517
Protein Sequence: 875 a.a.     [Download]
>gi|218534546|ref|YP_002401076.1| conjugal transfer ATP-binding protein TraC [Escherichia coli S88]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRESGRNSTARILNFHLARNPEIAFL
WNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA
 
Nucleotide Sequence: 2628 bp     [Download]
>gi|218534477|ref|NC_011747.1|:56902-59529 Escherichia coli S88 plasmid pECOS88, complete sequence
GTGAATAACCCACTTGAGGCCGTCACTCAGGCGGTTAACTCCCTCGTCACAGCACTGAAACTGCCTGACG
AATCCGCAAAGGCCAATGAAGTTCTGGGCGAAATGAGCTTCCCGCAGTTCAGCCGTCTGCTGCCGTACCG
TGATTACAACCAGGAATCCGGTCTGTTCATGAATGACACCACGATGGGCTTTATGCTGGAAGCCATTCCC
ATCAATGGGGCGAATGAGTCCATTGTGGAGGCCCTCGATCACATGCTGCGCACCAAACTGCCGCGCGGTA
TTCCGTTGTGTATCCATCTGATGTCCAGTCAGCTGGTTGGTGACAGGATTGAATACGGGCTGCGTGAGTT
CTCCTGGTCAGGTGAACAGGCTGAACGGTTTAACGCCATTACCCGGGCCTATTATATGAAAGCGGCAGCG
ACACAGTTTCCGCTGCCGGAGGGGATGAATCTGCCCCTGACCCTGCGCCATTACCGGGTGTTTATCTCGT
ACTGTTCTCCTTCGAAGAAAAAAAGCCGGGCCGACATTCTGGAAATGGAAAACCTGGTGAAAATCATCCG
GGCGTCGTTACAGGGGGCCAGTATCACCACACAGACGGTGGATGCACAGGCCTTTATCGATATTGTCGGG
GAGATGATTAACCATAACCCGGACTCCCTGTACCCGAAAAGACGCCAGCTGGACCCGTATTCTGATCTGA
ATTATCAGTGTGTGGAGGACAGTTTTGACCTGAAAGTCCGGGCTGATTACCTGACGCTGGGCCTGCGTGA
GAGCGGCAGGAACAGTACGGCCCGCATCCTGAATTTCCATCTGGCCCGTAACCCGGAAATCGCTTTTTTG
TGGAACATGGCCGACAACTACAGCAACCTGCTGAACCCGGAGTTGTCCATCTCCTGCCCGTTCATCCTGA
CGCTGACTCTGGTGGTGGAAGACCAGGTGAAAACCCACAGCGAAGCCAACCTGAAGTACATGGACCTGGA
GAAAAAGTCGAAGACCTCCTATGCCAAATGGTTTCCGTCCGTGGAGAAAGAAGCGAAGGAGTGGGGGGAA
CTGCGTCAGCGGCTGGGCTCCGGTCAGTCCTCTGTCGTGTCCTACTTCCTCAACATCACAGCCTTCTGCA
AGGACAATAATGAAACGGCACTGGAAGTGGAGCAGGACATCCTGAACAGCTTCCGTAAAAACGGTTTTGA
GCTGATTTCACCGCGCTTTAACCACATGCGCAATTTCCTGACCTGTCTGCCCTTTATGGCCGGGAAAGGG
TTGTTTAAACAGCTGAAAGAGGCCGGAGTGGTACAGCGCGCAGAGAGCTTTAATGTGGCCAACCTGATGC
CGTTAGTGGCGGATAACCCCCTGACACCGGCAGGTCTGCTGGCACCCACCTACCGTAACCAGCTGGCGTT
TATCGATATTTTCTTCCGGGGGATGAATAACACCAACTATAACATGGCGGTCTGTGGCACCTCCGGGGCC
GGTAAAACCGGGCTGATACAGCCACTTATCCGCAGCGTGCTGGACTCCGGAGGCTTTGCCGTGGTGTTCG
ACATGGGGGATGGATACAAGTCCCTGTGTGAGAACATGGGCGGGGTGTATCTGGACGGTGAAACCCTGCG
CTTTAACCCGTTTGCGAACATCACCGATATTGACCAGTCAGCGGAGCGTGTCCGTGACCAGCTGTCGGTG
ATGGCCAGCCCCAACGGTAACCTGGATGAAGTGCATGAAGGTCTGCTGCTGCAGGCAGTCAGGGCATCAT
GGCTGGCCAAAGAGAACAGGGCACGTATTGATGACGTGGTGGATTTCCTGAAAAACGCCAGTGACAGCGA
GCAGTATGCCGAGTCACCGACCATCCGCAGCCGTCTGGACGAAATGATTGTGCTGCTTGACCAGTACACT
GCTAACGGCACTTATGGCCAGTATTTCAACTCCGATGAGCCGTCCCTGCGGGATGATGCGAAAATGGTGG
TGCTGGAGCTGGGCGGACTGGAAGACCGTCCGTCCCTGCTGGTTGCGGTGATGTTCAGCCTTATCATTTA
CATTGAGAACCGGATGTACCGCACGCCGCGTAACCTCAAGAAACTGAACGTCATTGATGAAGGCTGGCGT
CTGCTGGACTTCAAAAATCACAAGGTCGGTGAATTTATTGAGAAAGGCTACCGTACCGCCCGCCGTCATA
CCGGTGCCTATATCACCATCACCCAGAACATCGTCGACTTTGACTCTGACAAGGCCTCCAGTGCGGCCCG
TGCAGCATGGGGTAACTCCTCCTACAAAATTATCCTCAAACAGAGTGCGAAGGAGTTCGCGAAATACAAC
CAGCTGTATCCGGACCAGTTCCTGCCACTGCAGCGTGACATGATTGGTAAGTTCGGTGCGGCCAAAGATC
AGTGGTTCAGTTCCTTCCTGCTGCAGGTGGAAAACCATTCCTCCTGGCACCGCCTGTTTGTGGACCCGTT
AAGCCGCGCCATGTACAGCTCTGACGGCCCGGATTTTGAGTTTGTGCAGCAGAAACGTAAAGAGGGGCTG
AGTATTCATGAGGCAGTGTGGCAGCTGGCGTGGAAGAAGTCAGGGCCGGAGATGGCTTCGCTGGAAGCCT
GGCTGGAAGAACATGAGAAATACAGGAGTGTTGCATGA
 Primer design