SecReT4
Protein ID: 218534548
T4SS name [ID]Tra_F [89]
Gene symboltraW
Locus tagpECS88_0079
StrainEscherichia coli S88
Repliconplasmid pECOS88 [GenBank: NC_011747] [Browse all T4SS(s) in this replicon]
Location [Strand]59909..60541 [+]
Productconjugal transfer pilus assembly protein TraW
Component typeTraW_F
UniProt IDB7LI77
KEGG IDecz:pECS88_0079
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 7.6e-11, Aligned region: 1..30
Protein Sequence: 210 a.a.     [Download]
>gi|218534548|ref|YP_002401078.1| conjugal transfer pilus assembly protein TraW [Escherichia coli S88]
MRCRGLIALLIWGQSVAAADLGTWGDLWPVKEPDMLTVIMQRLTALEQSGEMGRKMDAFKERVIRNSLRP
PAVPGIGRTEKYGSRLFDPSVRLAADIRDNEGRVFARQGEVMNPLQYVPFNQTLYFINGDDPAQVAWMKR
QTPPTLESKIILVQGSIPEMQKSLDSRVYFDQNGVLCQRLGIDQVPARVSAVPGDRFLKVEFIPAEEGRK
 
Nucleotide Sequence: 633 bp     [Download]
>gi|218534477|ref|NC_011747.1|:59909-60541 Escherichia coli S88 plasmid pECOS88, complete sequence
ATGAGATGCCGGGGGCTGATTGCCCTGCTGATATGGGGGCAGAGTGTGGCCGCCGCCGATCTTGGTACCT
GGGGCGATCTGTGGCCGGTAAAGGAGCCGGACATGCTGACGGTGATCATGCAGCGCCTGACGGCACTGGA
GCAGTCCGGTGAGATGGGCCGGAAAATGGATGCCTTTAAGGAGCGGGTGATCCGCAACAGTCTGCGGCCC
CCTGCCGTGCCCGGTATCGGACGCACGGAGAAATACGGCAGCCGGTTGTTTGACCCGTCCGTCAGACTGG
CTGCGGATATCCGGGATAACGAAGGGCGGGTGTTTGCCCGTCAGGGTGAAGTGATGAATCCGCTGCAGTA
TGTTCCTTTTAACCAGACGCTGTATTTCATCAATGGCGATGATCCGGCGCAGGTGGCCTGGATGAAACGC
CAGACGCCGCCCACACTGGAGAGCAAAATTATCCTCGTGCAGGGCAGTATCCCGGAGATGCAGAAGTCTC
TGGACAGCCGTGTTTACTTTGACCAGAACGGTGTGCTCTGCCAGCGCCTCGGCATTGATCAGGTCCCGGC
ACGGGTGAGCGCCGTTCCCGGCGATCGCTTCCTGAAGGTGGAATTTATTCCGGCAGAGGAGGGCAGAAAA
TGA
 Primer design