SecReT4
Protein ID: 218534549
T4SS name [ID]Tra_F [89]
Gene symboltraU
Locus tagpECS88_0080
StrainEscherichia coli S88
Repliconplasmid pECOS88 [GenBank: NC_011747] [Browse all T4SS(s) in this replicon]
Location [Strand]60538..61530 [+]
Productconjugal transfer pilus assembly protein TraU
Component typeTraU_F
UniProt IDB7LI78
KEGG IDecz:pECS88_0080
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 2.4e-84, Aligned region: 29..329
Protein Sequence: 330 a.a.     [Download]
>gi|218534549|ref|YP_002401079.1| conjugal transfer pilus assembly protein TraU [Escherichia coli S88]
MKRSLWLLMLFLLAGHVPAASADSACEGRFVNPITDICWSCIFPLSLGSIKVSQGKVPDTANPSMPIQIC
PAPPPLFRRIGLAIGYWEPMALTDVTRSPGCMVNLGFSLPAFGKTAQGTAKKDEKQVNGAFYHVHWYKYP
LTYWLNIITSLGCLEGGDLDIAYLSEIDPTWTDSSLTTILNPEAVIFANPIAQGACAADAIASAFNMPLD
VLFWCAGSQGSMYPFNGWVSNESSPLQSSLLVSERMAFKLHRQGMIMETIGKNNAVCNEYPSPILPKERW
RYQMVNMYPDSGQCHPFGRSVTRWETGKNPPNTKKNFGYLMWRKRNCVFL
 
Nucleotide Sequence: 993 bp     [Download]
>gi|218534477|ref|NC_011747.1|:60538-61530 Escherichia coli S88 plasmid pECOS88, complete sequence
ATGAAGCGAAGCCTGTGGCTGCTGATGTTATTCCTTCTCGCCGGTCATGTCCCTGCAGCGTCTGCGGATT
CTGCCTGTGAGGGGCGTTTTGTAAACCCGATCACGGATATCTGCTGGAGCTGTATTTTCCCGCTCTCGCT
GGGCAGTATCAAAGTCAGTCAGGGTAAGGTCCCCGACACGGCGAACCCGTCGATGCCCATTCAGATTTGT
CCGGCACCGCCGCCGCTGTTCAGGCGTATCGGGCTGGCCATTGGTTACTGGGAGCCGATGGCGCTGACGG
ACGTCACCCGATCACCGGGATGCATGGTTAACCTGGGCTTCAGCCTGCCGGCTTTTGGTAAAACGGCACA
GGGAACGGCGAAAAAGGATGAGAAGCAGGTGAACGGGGCGTTCTATCACGTTCACTGGTACAAATACCCG
CTGACGTACTGGCTTAACATCATCACATCGCTGGGCTGTCTGGAAGGTGGTGACCTGGATATCGCTTATC
TTTCTGAAATCGACCCCACCTGGACGGACAGCAGCCTGACCACCATTCTCAATCCGGAAGCTGTCATCTT
TGCCAATCCGATAGCACAGGGGGCCTGTGCAGCAGATGCCATTGCCAGCGCCTTTAATATGCCTCTCGAT
GTTCTGTTCTGGTGTGCCGGTTCGCAGGGCAGTATGTACCCGTTCAATGGCTGGGTGAGTAATGAGTCCA
GTCCGTTGCAGTCCTCCCTGCTGGTCAGTGAACGCATGGCGTTCAAGCTGCACCGTCAGGGCATGATTAT
GGAAACCATCGGGAAAAATAACGCCGTCTGTAATGAATATCCGTCCCCAATCCTGCCCAAAGAACGCTGG
CGTTACCAGATGGTGAATATGTACCCGGACAGCGGACAGTGCCACCCGTTCGGGCGCAGTGTGACCCGCT
GGGAAACCGGGAAAAATCCGCCCAATACAAAGAAAAACTTCGGCTACCTGATGTGGCGTAAACGTAACTG
TGTCTTCCTGTGA
 Primer design