SecReT4
Protein ID: 218534550
T4SS name [ID]Tra_F [89]
Gene symboltrbC
Locus tagpECS88_0081
StrainEscherichia coli S88
Repliconplasmid pECOS88 [GenBank: NC_011747] [Browse all T4SS(s) in this replicon]
Location [Strand]61536..62177 [+]
Productconjugal transfer pilus assembly protein TrbC
Component typeTrbC_F
UniProt IDB7LI79
KEGG IDecz:pECS88_0081
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 4.4e-28, Aligned region: 94..192
Protein Sequence: 213 a.a.     [Download]
>gi|218534550|ref|YP_002401080.1| conjugal transfer pilus assembly protein TrbC [Escherichia coli S88]
MMKLSMKSLAALLMMLNGAVMASENVNTPENRQFLKQQENLSRQLREKPDHQLKAWAEKQVLENPLQRSD
NHFLDELVRKQQASQDGKPRQGALYFVSFSIPEEGLKRMLGETRHYGIPATLRGMVNNDLKTTAEAVLSL
VKDGATDGVQIDPTLFSQYGIRSVPALVVFCSQGYDIIRGNLRVGQALEKVAATGDCRQVAHDLLAGKGV
SGK
 
Nucleotide Sequence: 642 bp     [Download]
>gi|218534477|ref|NC_011747.1|:61536-62177 Escherichia coli S88 plasmid pECOS88, complete sequence
ATGATGAAGCTGAGTATGAAATCTCTGGCAGCACTGCTGATGATGCTGAACGGGGCGGTTATGGCGTCAG
AAAACGTGAACACTCCTGAAAACCGCCAGTTCCTGAAGCAGCAGGAAAATTTAAGCAGACAACTGCGTGA
AAAACCTGACCATCAGCTGAAAGCCTGGGCGGAGAAGCAGGTGCTGGAAAACCCCCTTCAGCGTTCAGAT
AACCATTTCCTGGATGAGCTGGTTCGTAAACAGCAGGCTTCGCAGGACGGGAAACCCCGGCAGGGTGCTC
TGTATTTTGTGTCGTTTTCCATTCCCGAAGAGGGGCTGAAACGAATGCTGGGCGAAACCCGGCACTACGG
TATACCCGCCACACTGCGGGGCATGGTGAACAATGACCTGAAGACCACCGCTGAAGCCGTGCTGTCCCTG
GTGAAAGACGGCGCGACTGATGGTGTTCAGATCGACCCGACGCTGTTTTCACAGTACGGCATTCGCAGTG
TACCGGCACTGGTGGTGTTCTGCAGTCAGGGATACGACATCATCCGGGGAAACCTGCGGGTCGGCCAGGC
GCTGGAGAAAGTGGCCGCCACGGGTGACTGCCGGCAGGTGGCTCATGATTTACTGGCAGGGAAAGGAGTT
TCCGGGAAATGA
 Primer design