SecReT4
Protein ID: 218534551
T4SS name [ID]Tra_F [89]
Gene symboltraN
Locus tagpECS88_0082
StrainEscherichia coli S88
Repliconplasmid pECOS88 [GenBank: NC_011747] [Browse all T4SS(s) in this replicon]
Location [Strand]62174..63982 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDB7LI80
KEGG IDecz:pECS88_0082
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 5.8e-74, Aligned region: 306..552
Protein Sequence: 602 a.a.     [Download]
>gi|218534551|ref|YP_002401081.1| conjugal transfer mating pair stabilization protein TraN [Escherichia coli S88]
MKRILPLILALVAGMAQADSNSDYRAGSDFAHQIKGQGSSSIQGFKPQESIPGYNANPDETKYYGGVTAG
GDGGLKNDGTTEWATGETGKTITESFMNKPKDILSPDAPFIQTGRDVVNRADSIVGNTGQQCSAQEISRS
EYTNYTCERDLQVEQYCTRTARMELQGSTTWETRTLEYEMSQLPAREVNGQYVVSITSPVTGEIVNAHYS
WSRTYLQKSVPMTITVLGTPLSWNAKYSADASFTPVQKTLTAGVAFTSSHPVRVGNTKFKRHTAMKLRLV
VRVKKASYTPYVVWSESCPFSKELGKLTKTECTEAGGNRTLVKDGQSYSMYQSCWAYRDTYVTQSADKGT
CQTYADNPACTLVSHQCTFYSEEGACLHEYATYSCESKTSGKVMVCGGDVFCLDGECDKAQSGKSNDFAE
AVSQLAALAAAGKDVAALNGVDVRAFTGQAKFCKKAAAGYSNCCKDSGWGQDIGLAKCSSDEKALAKAKS
NKLTVSVGEFCSKKVLGVCLEKKRSYCQFDSKLAQIVQQQGRNGQLRISFGSAKHPDCRGITVDELQKIQ
FDRLDFTNFYEDLMNNQKIPDSGVLTQKVKEQIADQLKQAGQ
 
Nucleotide Sequence: 1809 bp     [Download]
>gi|218534477|ref|NC_011747.1|:62174-63982 Escherichia coli S88 plasmid pECOS88, complete sequence
ATGAAACGTATTTTACCTCTGATACTGGCTCTGGTTGCCGGCATGGCACAGGCTGACAGCAACAGTGATT
ACCGGGCCGGTTCTGATTTTGCTCACCAGATCAAAGGGCAGGGAAGCAGCAGTATTCAGGGCTTTAAGCC
ACAGGAGAGTATCCCCGGCTATAACGCGAATCCGGACGAGACAAAATACTACGGTGGCGTGACTGCCGGC
GGGGATGGCGGCCTGAAAAATGACGGCACCACGGAATGGGCGACCGGTGAAACCGGAAAAACCATCACAG
AGTCATTCATGAACAAGCCGAAAGACATTCTTTCACCGGATGCACCGTTTATCCAGACCGGCAGGGATGT
GGTGAACCGGGCTGACAGCATTGTGGGAAACACCGGGCAGCAGTGCAGTGCGCAGGAGATTAGCCGGAGT
GAATACACGAATTACACCTGTGAGCGGGATTTACAGGTGGAGCAGTACTGCACACGAACTGCCCGTATGG
AGCTGCAGGGGAGTACCACATGGGAAACCCGGACGCTGGAGTATGAAATGAGTCAGCTACCTGCACGTGA
AGTGAATGGTCAGTATGTTGTCTCCATTACCTCTCCCGTTACCGGTGAAATTGTCAATGCGCATTACAGC
TGGAGTCGTACTTACCTGCAGAAGAGTGTACCTATGACAATTACAGTACTGGGAACCCCACTGAGCTGGA
ATGCCAAATACTCAGCAGATGCCTCATTTACACCAGTACAGAAAACACTGACTGCCGGTGTTGCTTTTAC
GTCATCTCACCCCGTCCGGGTCGGGAATACAAAATTCAAACGTCATACGGCAATGAAGCTGCGTCTGGTT
GTCAGGGTAAAAAAAGCCTCGTACACCCCGTATGTTGTCTGGTCTGAAAGCTGCCCGTTCAGCAAGGAGC
TGGGGAAACTGACAAAAACAGAATGTACGGAGGCTGGCGGGAACAGGACGCTGGTGAAAGACGGTCAGTC
ATACAGCATGTACCAGAGCTGCTGGGCATACCGGGACACGTATGTCACACAGTCAGCAGACAAGGGAACC
TGTCAGACCTACGCCGACAATCCTGCCTGTACCCTGGTGTCACACCAGTGCACCTTTTACTCCGAAGAAG
GTGCCTGTCTGCATGAATATGCCACGTACTCCTGTGAGTCAAAAACATCCGGGAAAGTGATGGTCTGTGG
GGGAGACGTCTTCTGTCTCGATGGCGAATGCGATAAGGCTCAGAGCGGGAAGAGTAATGATTTTGCCGAA
GCCGTTTCTCAGCTGGCGGCACTGGCCGCAGCAGGTAAGGATGTTGCGGCGCTGAACGGGGTGGATGTCC
GTGCTTTCACCGGTCAGGCGAAATTTTGTAAGAAGGCTGCAGCCGGATACAGCAACTGCTGTAAGGACAG
CGGCTGGGGACAGGATATCGGGCTGGCCAAATGCAGCAGTGATGAAAAAGCCCTGGCTAAAGCAAAATCA
AACAAACTGACCGTCAGTGTCGGAGAGTTCTGTTCGAAGAAAGTGCTGGGTGTCTGCCTGGAGAAAAAAC
GCAGTTACTGTCAGTTTGATTCGAAGCTGGCGCAGATAGTCCAGCAGCAGGGGCGCAACGGACAGCTGCG
TATCAGTTTTGGCAGTGCGAAGCATCCTGACTGTCGGGGGATTACGGTTGATGAGCTGCAGAAAATTCAG
TTCGACAGACTGGATTTCACTAACTTCTACGAAGACCTGATGAATAACCAGAAAATCCCGGACAGTGGTG
TTCTGACGCAGAAAGTGAAAGAGCAGATTGCTGACCAGCTGAAACAGGCAGGACAGTAA
 Primer design