SecReT4
Protein ID: 218534553
T4SS name [ID]Tra_F [89]
Gene symboltraF
Locus tagpECS88_0084
StrainEscherichia coli S88
Repliconplasmid pECOS88 [GenBank: NC_011747] [Browse all T4SS(s) in this replicon]
Location [Strand]64229..65002 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDB7LI82
KEGG IDecz:pECS88_0084
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 6.1e-77, Aligned region: 33..247
Protein Sequence: 257 a.a.     [Download]
>gi|218534553|ref|YP_002401083.1| conjugal pilus assembly protein TraF [Escherichia coli S88]
MKEKVMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAASRQEPDIMQKLAALQT
ATKRALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAADQ
VQQRQAIAKLAEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQR
LGVKYFPAMMLVDPKQGSVRPLSYGFISQDYLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 774 bp     [Download]
>gi|218534477|ref|NC_011747.1|:64229-65002 Escherichia coli S88 plasmid pECOS88, complete sequence
ATGAAAGAAAAAGTGATGAAAGGAATGAAGATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTA
TTTTTCCGGCGTCAGGAAAAGATGCAGGCTGGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGA
AAATAAACCAGTACCTGCAGCCTCCCGTCAGGAGCCGGACATTATGCAGAAACTGGCCGCACTGCAGACG
GCAACAAAGCGGGCGCTGTATGAAGCTATTCTGTATCCCGGCGTGGATAATTTTGTGAAATATTTCCGGC
TGCAGAATTACTGGACTCAGCAGGCCGGGCTTTTCACCATGAGCGCCAAAAAAGCCATGCTGGCGCATCC
CGAACTGGACTATAACCTGCAGTACAGCCATTACAACGGCACGGTCCGGAACCAGCTGGCGGCAGACCAG
GTGCAGCAGCGACAGGCCATTGCGAAACTGGCTGAACACTACGGCATCATGTTCTTTTACCGGGGGCAGG
ACCCCATCGACGGGCAGCTGGCGCAGGTCATTAATGGCTTCAGGGATACCTATGGTCTGAGTGTTATTCC
CGTTTCCGTGGATGGCGTGATTAATCCGCTGTTGCCGGATTCCAGGACTGACCAGGGGCAGGCGCAGCGC
CTCGGCGTGAAATATTTCCCGGCCATGATGCTGGTTGACCCGAAACAGGGCAGTGTTCGCCCGTTATCAT
ACGGTTTTATTTCGCAGGACTACCTGGCAAAACAATTCCTGAACGTTTCTGAAGATTTTAAACCCAATTT
TTAA
 Primer design