SecReT4
Protein ID: 218534554
T4SS name [ID]Tra_F [89]
Gene symboltraQ
Locus tagpECS88_0085
StrainEscherichia coli S88
Repliconplasmid pECOS88 [GenBank: NC_011747] [Browse all T4SS(s) in this replicon]
Location [Strand]65484..65768 [+]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDB7LI83
KEGG IDecz:pECS88_0085
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 2.3e-51, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|218534554|ref|YP_002401084.1| conjugal transfer pilin chaperone TraQ [Escherichia coli S88]
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSRE
EREALEARQQAMMEGQQEGRHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|218534477|ref|NC_011747.1|:65484-65768 Escherichia coli S88 plasmid pECOS88, complete sequence
ATGATAAGTAAACGCAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGTTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCCCGTGTCAGCCGGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCAGACATGTCTCTC
ATTAA
 Primer design