SecReT4
Protein ID: 218534557
T4SS name [ID]Tra_F [89]
Gene symboltraH
Locus tagpECS88_0088
StrainEscherichia coli S88
Repliconplasmid pECOS88 [GenBank: NC_011747] [Browse all T4SS(s) in this replicon]
Location [Strand]66589..67965 [+]
Productconjugal transfer pilus assembly protein TraH
Component typeTraH_F
UniProt IDB7LI86
KEGG IDecz:pECS88_0088
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 2.9e-117, Aligned region: 30..379
Protein Sequence: 458 a.a.     [Download]
>gi|218534557|ref|YP_002401087.1| conjugal transfer pilus assembly protein TraH [Escherichia coli S88]
MMPRIKPLLVLCAALLTVTPAASADVNSDMNQFFNKLGFASNTTQPGVWQGQAAGYAYGGSLYARTQVKN
VQLISMTLPDINAGCGGIDAYLGSFSFINGEQLQRFVKQIMSNAAGYFFDLALQTTVPEIKTAKDFLQKM
ASDINSMNLSSCQAAQGIIGGLFPRTQVSQQKVCQDIAGESNIFADWAASRQGCTVGGKSDSVRDKASDK
DKERVTKNINIMWNALSKNRMFDGNKELKEFVMTLTGSLVFGPNGEITPLSARTTDRSIIRAMMEGGTAK
IYHCNDSDKCLKVVADTPVTISRDNALKSQITKLLASIQNKAVSDTPLDDKEKGFISSTTIPVFKYLVDP
QMLGVSNSMIYQLTDYIGYDILLQYIQELIQQARAMVATGNYDEAVIEHINDNMNDATRQIAAFQSQVQV
QQDALLVVDRQMSYMRQQLSARMLSRYQNNYHFGGSTL
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|218534477|ref|NC_011747.1|:66589-67965 Escherichia coli S88 plasmid pECOS88, complete sequence
ATGATGCCACGCATTAAACCTCTTCTGGTTCTTTGTGCTGCTTTACTGACGGTCACACCCGCAGCGTCAG
CGGATGTGAACAGCGACATGAATCAGTTCTTTAACAAGCTGGGCTTCGCCTCCAATACCACACAGCCGGG
CGTCTGGCAGGGGCAGGCCGCCGGTTATGCTTACGGTGGCTCCCTGTATGCCCGTACTCAGGTCAAAAAT
GTTCAGCTGATTTCCATGACGCTGCCGGATATCAATGCCGGATGTGGCGGCATCGACGCCTATCTCGGCT
CGTTCAGTTTTATTAATGGCGAGCAGCTGCAGCGTTTTGTTAAGCAGATTATGAGCAATGCTGCCGGTTA
CTTTTTTGACCTTGCCCTGCAGACAACGGTGCCGGAAATCAAAACCGCAAAAGACTTCCTGCAGAAAATG
GCAAGCGACATTAACAGTATGAACCTCAGTTCCTGCCAGGCGGCACAGGGGATTATCGGCGGGCTCTTCC
CCCGGACGCAGGTGTCCCAGCAGAAAGTCTGTCAGGACATTGCCGGTGAGAGCAATATTTTTGCTGACTG
GGCGGCTTCCCGGCAGGGATGTACCGTTGGCGGGAAATCTGACAGTGTCAGGGATAAAGCCAGCGACAAG
GATAAGGAGCGGGTGACCAAAAACATCAACATCATGTGGAATGCGCTTTCCAAAAACAGAATGTTTGACG
GCAACAAAGAGCTGAAAGAGTTTGTGATGACGCTGACCGGCTCACTGGTGTTTGGTCCTAACGGCGAAAT
CACACCCTTGTCAGCCAGAACCACTGACCGCTCAATTATCCGGGCCATGATGGAAGGCGGCACAGCAAAA
ATTTATCACTGCAACGATTCTGATAAATGCCTGAAAGTGGTGGCAGACACACCGGTGACCATCAGCCGGG
ATAATGCACTGAAGTCTCAGATTACTAAACTTCTGGCCAGCATTCAGAACAAGGCGGTCAGTGACACGCC
TCTGGATGACAAGGAAAAAGGCTTTATTTCCAGTACCACCATCCCCGTCTTCAAATACCTGGTTGACCCG
CAGATGCTCGGTGTTTCCAACAGTATGATTTACCAGCTGACGGACTATATCGGTTACGACATCCTGCTGC
AGTACATTCAGGAGCTGATACAGCAGGCCCGGGCGATGGTGGCCACAGGAAATTATGACGAAGCAGTTAT
CGAACATATTAACGACAACATGAATGATGCCACCCGGCAGATTGCGGCGTTTCAGTCGCAGGTGCAGGTA
CAGCAGGATGCGCTGCTGGTTGTCGATCGTCAGATGAGCTACATGCGTCAGCAGCTTTCCGCCCGCATGC
TCAGTCGTTACCAGAACAACTATCACTTCGGAGGGAGCACGCTGTGA
 Primer design