SecReT4
Protein ID: 218534558
T4SS name [ID]Tra_F [89]
Gene symboltraG
Locus tagpECS88_0089
StrainEscherichia coli S88
Repliconplasmid pECOS88 [GenBank: NC_011747] [Browse all T4SS(s) in this replicon]
Location [Strand]67962..70472 [+]
Productconjugal transfer mating pair stabilization protein TraG
Component typeTraG_F
UniProt IDB7LI87
KEGG IDecz:pECS88_0089
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 3.3e-127, Aligned region: 3..450
Protein Sequence: 836 a.a.     [Download]
>gi|218534558|ref|YP_002401088.1| conjugal transfer mating pair stabilization protein TraG [Escherichia coli S88]
MNEVYVIAGGEWLRNNLNAIAAFMGTRTWDSIEKIALTLSVLAVAVMWVQRHNVMDLLGWVAVFVLISLL
VNVRTSVQIIDNSDLVKVHRVDNVPVGLAMPLSLTTRIGHAMVASYEMIFTQPDSVTYSKTGMLFGAELV
SKSTDFLSRNPEIANLFQDYVQNCVMGDIYLNHKYTLEELMASADPYTLIFSRPSPLRGVYDSNNNFVTC
KDASVLLKDKLNLDTQSGGKTWHYYAQQLFGGRPDPNLLFSTLIGDSYSYFYGSSKSASQIIRQNVTINA
LKEGITSYAARNGDSASLVNLATTSSMEKQRLAHVSIGHVAMRTLPMTQTILTGIAIGIFPLLVLAAVFN
KLTLSVLKGYVFALMWLQSWPMLYAILNSAMTFYAKQNGAPVVLSEISQIQLKYSDLASTAGYLSMMIPP
LSWMMVRGLGAGFSSVYSHFASSAISPTASAAGSVVDGNYSYGNMQTENVNGFSWSTNSTTSFGQMMYQT
GSGATATQTRDGNMVMDASGAMSRLPVGINATRQIAAAQQEMAREASNRAESALHGFSSSIASAWNSLSQ
FGSNRGSSDSVTGGADSTMSAQDSMMASRMRSAVESYAKAHNISNEQATRELASRSTRGSAGMYGDAHAE
WGVKPKILGVGGGVGVRGGGRASIDWSDEDAHQASSGSRASHDTRHDIDARATQDFKEASDYFTSRKVSE
SGSHTDNNADSRVDQLSAALNSAKQSYDQYTTNMTRSHEYAEMASRTESMSGQMSEDLSQQFAQYVMKHA
PQDAEAILTNTSSPEIAERRRAMAWSFVQEQVQPGVDNAWRESRGDIGKGMESVPSGGGGQPGYYC
 
Nucleotide Sequence: 2511 bp     [Download]
>gi|218534477|ref|NC_011747.1|:67962-70472 Escherichia coli S88 plasmid pECOS88, complete sequence
GTGAATGAAGTTTATGTGATTGCCGGTGGTGAGTGGTTGCGGAATAACCTGAACGCCATTGCCGCCTTTA
TGGGAACCAGGACGTGGGATTCCATTGAAAAAATTGCGCTCACATTGTCTGTTCTCGCGGTGGCCGTGAT
GTGGGTACAGCGGCACAACGTGATGGATTTGCTGGGCTGGGTGGCCGTGTTTGTGCTTATCAGCCTGCTG
GTTAATGTCCGCACATCGGTGCAGATTATTGATAACAGTGACCTGGTCAAAGTTCACCGGGTGGATAATG
TACCGGTCGGACTGGCGATGCCACTTTCACTGACGACCCGTATCGGGCATGCAATGGTGGCCAGTTACGA
GATGATCTTCACGCAACCGGACAGTGTCACCTACAGCAAAACGGGGATGCTGTTTGGCGCAGAACTGGTA
TCAAAAAGCACCGACTTTTTGTCCCGCAATCCGGAAATCGCCAATCTTTTCCAGGATTATGTGCAGAACT
GCGTGATGGGGGATATTTACCTGAACCACAAATACACGCTGGAGGAGCTGATGGCCTCCGCTGATCCCTA
CACGCTGATTTTTTCCCGCCCCAGCCCGCTGCGGGGCGTTTATGACAGCAATAATAATTTCGTGACCTGT
AAGGACGCGTCGGTTTTGCTGAAAGACAAGCTGAATCTGGATACACAGAGTGGCGGAAAAACCTGGCATT
ATTATGCCCAGCAGCTATTTGGTGGACGCCCTGATCCGAACCTGTTGTTCAGTACGCTGATTGGCGACAG
TTACAGTTACTTCTATGGCTCAAGTAAATCAGCCAGCCAGATCATCCGCCAGAATGTCACCATCAATGCG
CTGAAGGAGGGGATCACCAGTTATGCCGCGCGTAATGGTGATTCAGCCAGCCTGGTGAATCTGGCCACCA
CGTCATCGATGGAGAAGCAACGTCTGGCACATGTCTCCATCGGTCATGTGGCGATGCGGACACTGCCCAT
GACGCAGACCATCCTGACGGGGATCGCCATCGGTATTTTCCCGCTTCTGGTACTGGCGGCTGTCTTCAAC
AAACTGACGCTGTCCGTCCTGAAAGGCTATGTGTTTGCCCTGATGTGGTTGCAGTCATGGCCAATGTTGT
ACGCCATTCTGAACAGCGCCATGACATTTTATGCGAAGCAGAATGGTGCACCGGTGGTGCTCTCGGAAAT
TTCACAGATACAGCTGAAATACTCCGATCTGGCTTCCACTGCCGGGTATCTTTCCATGATGATCCCGCCA
TTATCCTGGATGATGGTCAGGGGACTCGGGGCCGGATTTTCCAGTGTGTACAGCCATTTCGCTTCCTCTG
CTATCAGCCCGACTGCCAGTGCGGCAGGTAGTGTGGTTGACGGTAATTACTCCTACGGCAACATGCAGAC
GGAAAACGTGAACGGATTCAGCTGGAGCACCAACAGCACCACGTCGTTTGGTCAGATGATGTACCAGACC
GGCAGTGGCGCAACCGCCACACAGACTCGTGACGGTAATATGGTGATGGATGCGAGCGGGGCGATGTCCC
GTTTACCGGTCGGTATCAATGCAACGCGTCAGATTGCGGCGGCACAACAGGAAATGGCCCGGGAGGCGTC
GAACAGAGCAGAAAGCGCCCTGCATGGGTTCAGCAGCAGTATTGCCAGTGCCTGGAACTCGCTCAGTCAG
TTTGGTTCTAACCGGGGGAGCAGTGATTCTGTCACCGGTGGTGCTGACAGCACGATGAGCGCACAGGACT
CCATGATGGCCAGCCGTATGCGCAGCGCAGTGGAAAGCTATGCGAAGGCGCATAATATCAGTAATGAGCA
GGCGACAAGAGAACTGGCATCAAGAAGTACGAGAGGTTCTGCGGGGATGTATGGCGATGCTCATGCTGAA
TGGGGGGTTAAACCTAAAATTCTTGGTGTTGGTGGTGGCGTAGGTGTTAGAGGTGGTGGTCGGGCAAGTA
TTGACTGGAGTGATGAGGATGCGCATCAGGCCAGCAGTGGTTCACGGGCCAGCCATGATACTCGCCATGA
TATCGATGCCAGGGCTACACAAGACTTTAAAGAGGCCAGCGATTACTTTACCAGTCGCAAGGTCAGTGAA
TCCGGCAGCCATACGGACAATAATGCCGATTCCCGTGTGGACCAGCTGTCTGCAGCCCTGAACTCAGCAA
AACAGAGTTACGACCAGTACACGACGAATATGACCCGCAGCCATGAATATGCTGAAATGGCATCCCGTAC
TGAAAGCATGAGTGGGCAGATGAGTGAAGACCTGTCGCAACAGTTTGCACAGTATGTGATGAAACACGCG
CCGCAGGATGCCGAAGCTATTCTGACAAACACCAGTTCCCCGGAGATTGCAGAACGCCGTCGGGCTATGG
CGTGGTCTTTTGTTCAGGAACAGGTGCAGCCTGGTGTTGATAATGCCTGGCGTGAATCCCGTGGGGACAT
CGGTAAAGGAATGGAGAGCGTACCTTCGGGGGGGGGGGGGCAGCCAGGATATTATTGCTGA
 Primer design