SecReT4
Protein ID: 218534561
T4SS name [ID]Tra_F [89]
Gene symboltraD
Locus tagpECS88_0093
StrainEscherichia coli S88
Repliconplasmid pECOS88 [GenBank: NC_011747] [Browse all T4SS(s) in this replicon]
Location [Strand]72321..74474 [+]
Productconjugal transfer protein TraD
Component typeTraD_F
UniProt IDB7LI90
KEGG IDecz:pECS88_0093
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 3.3e-148, Aligned region: 172..561
TraD_N [PF12615], Evalue: 1.5e-33, Aligned region: 31..129
TraG-D_C [PF12696], Evalue: 1e-18, Aligned region: 419..541
AAA_10 [PF12846], Evalue: 2.3e-10, Aligned region: 399..491
T4SS-DNA_transf [PF02534], Evalue: 5.9e-08, Aligned region: 362..477
Protein Sequence: 717 a.a.     [Download]
>gi|218534561|ref|YP_002401091.1| conjugal transfer protein TraD [Escherichia coli S88]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTENPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGESFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQARPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQPVSPAI
NDKKSDSGVNVPAGGIEQELKMKPEEEMEQQLPPGSSESGEVVDMAAYEAWQQENHPDIQQQMQRREEVN
INVHRERGEDVEPGDDF
 
Nucleotide Sequence: 2154 bp     [Download]
>gi|218534477|ref|NC_011747.1|:72321-74474 Escherichia coli S88 plasmid pECOS88, complete sequence
ATGAGTTTTAACGCAAAGGATATGACCCAGGGCGGTCAGATTGCGTCCATGCGTATCCGCATGTTCAGCC
AGATCGCCAATATCATGCTTTACTGCCTGTTTATTTTTTTCTGGATACTCGTTGGTCTGGTTTTATGGGT
AAAAATAAGCTGGCAGACGTTTGTGAACGGCTGTATTTACTGGTGGTGTACCACGCTGGAGGGCATGCGG
GATTTAATCAAGTCCCAGCCGGTCTATGAGATCCAGTATTACGGCAAAACCTTCCGGATGAACGCTGCTC
AGGTACTGCATGATAAATATATGATCTGGTGCGGAGAGCAGCTATGGTCCGCATTCGTTCTGGCTACAGT
TGTGGCACTGGTTATTTGCCTGATTACCTTCTTTGTTGTCTCCTGGATTCTGGGGCGTCAGGGTAAACAA
CAGAGCGAAAATGAAGTCACAGGTGGTCGTCAGCTGACGGAGAACCCGAAAGACGTTGCCCGGATGCTGA
AAAAAGACGGCAAGGACTCCGATATACGGATTGGCGACCTGCCGATTATCCGGGATTCCGAAATCCAGAA
CTTCTGTCTGCACGGCACGGTCGGGGCCGGTAAGTCGGAAGTTATCCGTCGTCTGGCCAACTACGCCCGT
CAGCGTGGAGATATGGTGGTGATTTATGACCGTTCAGGGGAATTTGTTAAAAGTTACTATGATCCCTCCA
TCGATAAAATCCTGAATCCGCTGGATGCCCGCTGTGCCGCCTGGGATTTGTGGAAGGAGTGCCTGACACA
GCCGGATTTTGATAATACCGCAAATACTCTGATCCCGATGGGCACAAAAGAGGACCCGTTCTGGCAGGGT
TCAGGACGTACCATTTTTGCGGAAGCGGCGTACCTGATGCGTAATGACCCCAACCGCAGCTACAGCAAAC
TGGTGGACACACTGCTTTCCATCAAAATCGAAAAACTGCGTACCTTCCTGCGTAATTCACCGGCGGCCAA
CCTGGTGGAAGAGAAAATTGAGAAAACGGCGATTTCCATCCGTGCTGTGCTGACCAACTACGTGAAAGCC
ATCCGTTACCTGCAGGGGATTGAGCATAACGGTGAGTCTTTTACCATCCGTGACTGGATGCGGGGTGTCC
GGGAAGATCAGAAAAACGGCTGGTTGTTTATCTCGTCGAATGCCGACACCCATGCCTCCCTGAAGCCGGT
GATCTCCATGTGGCTGTCCATTGCCATTCGTGGTCTGCTGGCAATGGGAGAAAACCGTAACCGTCGTGTG
TGGTTTTTCTGTGATGAGCTACCCACGTTACACAAACTGCCGGACCTGGTGGAGATCCTGCCGGAAGCCC
GTAAGTTCGGTGGCTGTTATGTGTTTGGTATCCAGTCCTATGCCCAGCTGGAAGATATCTACGGTGAGAA
AGCGGCTGCCACGCTGTTTGACGTCATGAACACTCGTGCCTTTTTCCGTTCTCCCAGCCATAAGATTGCA
GAGTTCGCTGCCGGTGAGATTGGTGAGAAAGAGCACCTGAAAGCCAGCGAGCAGTATTCCTACGGTGCTG
ATCCGGTACGTGACGGGGTATCGACCGGTAAGGATATGGAGCGCCAGACGCTGGTCAGTTATTCCGACAT
TCAGTCTCTGCCGGATCTGACCTGTTATGTCACCCTGCCCGGACCGTATCCGGCAGTAAAACTCTCACTG
AAATATCAGGCACGTCCGAAGGTTGCCCCTGAGTTTATTCCGCGTGACATCAACCCAGAAATGGAGAACC
GTCTGAGTGCCGTACTTGCCGCAAGGGAAGCAGAAGGTCGTCAGATGGCCAGCCTCTTCGAACCGGATGT
GCCGGAAGTTGTTTCCGGAGAAGACGTGACTCAGGCTGAACAGCCGCAACAGCCGGTGTCTCCTGCCATA
AACGATAAGAAGTCAGATTCAGGTGTGAATGTTCCGGCAGGGGGGATCGAGCAGGAGCTGAAAATGAAAC
CGGAAGAAGAGATGGAACAGCAACTGCCACCCGGGAGCAGTGAATCCGGTGAAGTGGTGGATATGGCCGC
TTATGAGGCATGGCAACAGGAAAATCATCCGGACATCCAGCAGCAGATGCAGCGTCGTGAAGAGGTGAAC
ATTAATGTGCACCGGGAGCGTGGGGAGGATGTTGAGCCGGGAGATGATTTCTGA
 Primer design