SecReT4
Protein ID: 218534562
T4SS name [ID]Tra_F [89]
Gene symboltraI
Locus tagpECS88_0094
StrainEscherichia coli S88
Repliconplasmid pECOS88 [GenBank: NC_011747] [Browse all T4SS(s) in this replicon]
Location [Strand]74474..79744 [+]
Productconjugal transfer nickase/helicase TraI
Component typeTraI_F
UniProt IDB7LI91
KEGG IDecz:pECS88_0094
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 3.9e-87, Aligned region: 7..287
TraI [PF07057], Evalue: 6.2e-59, Aligned region: 1434..1560
AAA_30 [PF13604], Evalue: 2.4e-42, Aligned region: 968..1156
AAA_19 [PF13245], Evalue: 1.5e-05, Aligned region: 982..1047
UvrD_C_2 [PF13538], Evalue: 3e-05, Aligned region: 1341..1444
Protein Sequence: 1756 a.a.     [Download]
>gi|218534562|ref|YP_002401092.1| conjugal transfer nickase/helicase TraI [Escherichia coli S88]
MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRMQ
DGSNRHRPGYDLTFSAPKSVSMMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEA
LGYETEVVGKHGMWEMPGVPVEAFSGRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEVRMAEWMQT
LKETGFDIRAYRDAADQRAETRTQAPGAVSQEGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
NGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLLEGMAFTPGNTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRW
QGGEQRPATIISEPDRNVRYARLAGDFAASVKAGEESVAQVSGVREQVILTQAIRSELKTQGVLGHPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPASLPVADSPFTALKL
ESGWVETPGHSVSDSAKVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KARAGETLLETAISLQKAGLHTPAQQAIHLALPVLESKNLAFSMVDLLTEAKSFAAEGTSFTDLGGEINA
QIKRGDLLYVDVAKGYGTGLLISRASYEAEKSILRHILEGKEAVTPLMERVPGELMEKLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESGRPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVAIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRQEGAWAPEHSVTEFSHSQEAKLAEA
QQKAMLKGEAFPDVPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWETHRDALVLVDNVYHRIAGISKDDGLITLQDAEGNTRLISPREAVAEGVT
LYTPDTIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSGGQQTRVIRPAQVRAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGSRKLMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVF
EPKPDREVMNAERLFSTARELRDVAAGRAVLRQAGLAGGDTPARFIAPGRKYPQPYVALPAFDRNGKSAG
IWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
GRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLP
DSKTEQAVREIAGQERDRSAISEREAALPESVLRESQREREAVREVARENLLQERLQQMEQDMVRDLQKE
KTLGGD
 
Nucleotide Sequence: 5271 bp     [Download]
>gi|218534477|ref|NC_011747.1|:74474-79744 Escherichia coli S88 plasmid pECOS88, complete sequence
ATGATGAGTATCGCGCAGGTCAGATCGGCCGGAAGTGCCGGTAACTATTATACCGACAAGGATAATTACT
ATGTACTGGGCAGCATGGGAGAACGCTGGGCCGGCAGGGGGGCTGAACAGCTGGGACTGCAGGGCAGTGT
CGATAAGGATGTTTTTACCCGTCTTCTGGAGGGAAGGCTGCCGGACGGAGCGGATCTAAGCCGCATGCAG
GATGGCAGTAACAGGCATCGTCCCGGCTACGACCTGACCTTCTCCGCCCCCAAAAGTGTCTCCATGATGG
CCATGTTAGGTGGCGATAAGCGCCTGATTGATGCACATAACCAGGCCGTGGACTTTGCTGTTCGTCAGGT
GGAGGCGCTGGCCTCCACACGGGTGATGACGGACGGACAGTCAGAAACGGTACTGACCGGTAATCTGGTG
ATGGCACTGTTTAACCACGACACCAGTCGCGATCAGGAACCACAGTTACACACGCATGCGGTGGTGGCTA
ATGTCACGCAGCATAACGGTGAGTGGAAGACACTGAGCAGTGACAAAGTGGGGAAAACGGGGTTCATTGA
GAATGTGTACGCTAATCAGATTGCCTTTGGCAGGCTCTACCGGGAAAAACTGAAAGAGCAGGTTGAGGCG
CTGGGCTATGAAACCGAAGTGGTGGGTAAGCACGGTATGTGGGAGATGCCGGGCGTACCGGTGGAGGCCT
TTTCCGGACGCTCACAGGCAATCCGGGAGGCCGTCGGGGAAGATGCCTCGCTGAAATCCCGGGATGTGGC
GGCACTGGATACGCGAAAATCCAAACAGCACGTCGATCCTGAAGTCAGAATGGCTGAATGGATGCAGACG
CTGAAGGAAACCGGGTTCGACATCCGGGCATATCGTGACGCGGCGGATCAGCGTGCGGAGACCCGCACGC
AGGCGCCCGGGGCTGTTTCACAGGAGGGGCCGGATGTGCAGCAGGCGGTGACACAGGCCATTGCCGGATT
AAGTGAACGAAAAGTGCAGTTTACGTACACGGACGTGCTGGCCAGAACGGTCGGCATACTGCCGCCGGAA
AATGGTGTGATTGAACGGGCACGCGCCGGTATCGATGAGGCCATCAGCCGTGAGCAGCTTATCCCCCTCG
ATCGTGAGAAGGGGCTGTTCACGTCCGGGATTCATGTGCTCGATGAGCTGTCAGTCCGGGCACTCAGTCG
TGACATCATGAAACAGAACCGGGTGACCGTACATCCGGAGAAAAGTGTCCCCCGGACGGCCGGTTACAGC
GATGCCGTCAGTGTTCTGGCACAGGATCGCCCGTCGCTGGCCATTGTGTCCGGGCAGGGCGGTGCAGCCG
GGCAGCGTGAGCGGGTGGCTGAACTGGTCATGATGGCCCGGGAGCAGGGGCGGGAGGTGCAGATTATCGC
TGCTGACCGTCGCTCGCAGATGAACCTGAAGCAGGATGAACGGCTGTCCGGTGAGCTGATAACCGGACGT
CGTCAGCTGCTGGAAGGCATGGCCTTCACGCCGGGCAATACTGTTATCGTTGACCAGGGCGAAAAACTCT
CCCTGAAAGAGACGTTAACCCTGCTGGATGGTGCCGCACGTCATAACGTACAGGTCCTGATAACCGACAG
CGGGCAGCGAACCGGTACAGGCAGTGCACTTATGGCCATGAAGGATGCCGGGGTGAACACATATCGCTGG
CAGGGGGGAGAACAGCGACCGGCCACCATCATCAGTGAACCGGACCGCAATGTCCGTTATGCCCGGCTGG
CGGGAGATTTTGCGGCCAGCGTGAAAGCCGGAGAAGAGAGCGTGGCACAGGTCAGCGGGGTACGGGAACA
GGTCATACTGACACAGGCCATTCGCAGTGAGCTGAAAACACAGGGCGTGCTCGGACACCCGGAGGTGACC
ATGACCGCCCTGTCACCGGTCTGGCTGGACAGCCGGAGCCGTTATCTGCGGGATATGTACCGCCCGGGGA
TGGTGATGGAGCAGTGGAACCCGGAGACACGCAGTCATGACCGCTATGTGATAGACCGGGTGACGGCGCA
GAGTCACAGCCTGACCCTGCGGGATGCGCAGGGTGAAACGCAGGTGGTGCGTATTTCTTCTCTGGACAGC
AGCTGGTCGCTGTTCCGGCCGGAAAAAATGCCGGTGGCAGACGGCGAGCGTCTGAGGGTGACCGGGAAAA
TTCCCGGACTCCGCGTCTCCGGCGGTGACCGCTTGCAGGTGGCATCCGTCAGCGAGGACGCGATGACGGT
TGTTGTGCCGGGACGGGCTGAACCGGCCTCCCTGCCTGTGGCTGATTCACCGTTCACGGCACTGAAGCTG
GAGAGCGGCTGGGTGGAAACACCCGGGCATTCCGTCAGTGACAGTGCGAAGGTTTTTGCCTCCGTCACAC
AGATGGCAATGGACAATGCCACCCTGAACGGTCTGGCCCGCAGTGGTCGTGATGTCCGGCTGTATTCCTC
ACTGGATGAAACCCGTACTGCGGAAAAACTTGCCCGCCATCCCTCCTTTACGGTGGTTTCTGAGCAGATA
AAGGCGCGTGCCGGTGAGACATTGCTGGAAACCGCTATCAGTCTGCAGAAAGCAGGGCTTCACACGCCGG
CACAGCAGGCCATTCATCTGGCCCTTCCTGTGCTGGAAAGTAAAAACCTGGCCTTCAGCATGGTGGACCT
GCTGACAGAGGCGAAGTCGTTTGCTGCAGAAGGAACCAGTTTTACTGACCTGGGAGGGGAAATCAATGCG
CAGATAAAACGCGGTGATTTACTGTATGTGGATGTGGCAAAAGGCTATGGCACAGGCCTGCTGATTTCCC
GTGCGTCGTATGAGGCTGAAAAAAGCATTCTTCGCCATATTCTCGAAGGTAAGGAGGCGGTCACGCCGCT
GATGGAGAGAGTACCTGGCGAACTCATGGAGAAACTGACATCAGGACAGCGCGCCGCCACCCGCATGATA
CTGGAAACGTCCGACCGTTTCACGGTGGTGCAGGGCTATGCCGGTGTGGGGAAGACCACACAGTTCCGGG
CGGTGATGTCAGCCGTGAACATGCTGCCGGAGAGTGGGCGTCCCCGTGTCGTGGGGCTGGGGCCCACGCA
CCGCGCGGTCGGGGAGATGCGCAGCGCCGGCGTGGATGCACAGACACTGGCGTCATTTCTGCATGACACG
CAGCTGCAGCAGCGCAGCGGAGAAACACCGGATTTCAGCAACACGCTGTTCCTGCTCGATGAGAGCTCAA
TGGTGGGCAATACCGACATGGCACGGGCATACGCCCTGATTGCGGCCGGTGGTGGTCGTGCCGTGGCCAG
CGGTGACACGGACCAGCTGCAGGCCATCGCGCCCGGTCAGCCTTTCCGTCTCCAGCAGACGCGCAGTGCT
GCCGATGTGGCTATCATGAAAGAGATTGTGCGTCAGACGCCGGAACTGCGGGAGGCGGTATACAGCCTGA
TTAACCGGGATGTGGAAAGGGCATTGTCCGGGCTTGAGAGTGTGAAACCGTCTCAGGTGCCTCGTCAGGA
GGGCGCATGGGCACCGGAGCACTCTGTGACGGAGTTCAGTCACAGCCAGGAAGCGAAACTGGCAGAAGCG
CAGCAGAAGGCGATGCTGAAAGGCGAGGCTTTCCCGGATGTCCCCATGACACTGTATGAAGCCATTGTCC
GCGACTATACCGGCAGAACACCGGAAGCACGGGAGCAGACGCTGATTGTCACGCACCTGAATGAGGACCG
GCGCGTACTGAACAGCATGATTCATGATGCACGGGAAAAGGCCGGTGAGCTGGGGAAAGAGCAGGTCATG
GTGCCTGTCCTGAACACAGCGAATATACGCGACGGAGAGCTGCGTCGTCTCTCCACCTGGGAGACACATC
GGGACGCACTTGTCCTAGTGGATAATGTGTATCACCGGATTGCCGGTATCAGTAAGGATGACGGGCTGAT
AACCCTGCAGGATGCGGAAGGTAATACGCGGCTGATTTCGCCCCGGGAGGCGGTGGCTGAAGGCGTCACA
CTGTACACCCCGGACACCATCCGGGTAGGGACCGGTGACCGGATGCGCTTCACGAAGAGTGACCGGGAGC
GTGGTTATGTGGCCAACAGCGTCTGGACGGTGACAGCGGTTTCCGGTGACAGTGTCACGTTGTCGGGCGG
ACAGCAGACCCGGGTGATTCGCCCCGCCCAGGTGCGGGCAGAGCAACATATTGACCTGGCCTATGCCATC
ACCGCTCACGGTGCGCAGGGGGCAAGTGAAACCTTTGCCATCGCGCTTGAAGGTACGGAAGGCAGCCGGA
AACTGATGGCTGGCTTTGAGTCAGCCTACGTGGCCCTGTCGCGTATGAAGCAGCATGTGCAGGTGTACAC
CGATAACCGTCAGGGCTGGACGGATGCCATTAACAATGCCGTACAGAAAGGAACAGCCCACGATGTGTTT
GAACCGAAACCGGACCGGGAGGTCATGAATGCAGAGCGGCTGTTCAGTACGGCGCGGGAGCTGCGGGACG
TGGCGGCAGGGCGTGCCGTTCTTCGTCAGGCGGGGCTTGCCGGGGGAGACACTCCTGCACGGTTTATTGC
TCCGGGACGTAAATATCCACAGCCGTATGTGGCACTGCCGGCGTTTGACCGTAACGGCAAGTCTGCCGGT
ATCTGGCTGAACCCGCTGACCACGGATGACGGAAACGGGCTGCGGGGATTCAGTGGTGAAGGCCGTGTGA
AAGGCAGCGGGGATGCGCAGTTCGTGGCCCTGCAGGGCAGCCGTAACGGCGAGAGCCTGCTGGCTGATAA
TATGCAGGATGGTGTCCGGATTGCCCGTGATAACCCCGACAGCGGTGTGGTGGTGAGAATCGCCGGTGAA
GGTCGTCCGTGGAATCCCGGTGCCATCACCGGTGGCCGCGTGTGGGGGGATATCCCGGACAACAGCGTCC
AGCCGGGAGCCGGAAATGGCGAGCCGGTCACGGCAGAGGTACTGGCACAGCGGCAGGCTGAAGAGGCCAT
CCGCCGTGAAACGGAACGCCGCGCAGATGAAATTGTCCGTAAAATGGCAGAGAACAAACCTGACCTGCCG
GACAGCAAAACAGAGCAGGCTGTCAGGGAGATTGCCGGGCAGGAGCGTGACCGGTCTGCCATATCTGAAC
GGGAAGCCGCGCTGCCGGAGAGTGTGCTGCGTGAATCACAACGGGAGCGGGAAGCGGTCCGGGAGGTTGC
CCGGGAAAATCTGCTGCAGGAACGACTTCAGCAGATGGAGCAGGATATGGTTCGTGACCTGCAGAAAGAG
AAAACCCTGGGCGGAGACTGA
 Primer design