SecReT4
Protein ID: 218534563
T4SS name [ID]Tra_F [89]
Gene symboltraX
Locus tagpECS88_0095
StrainEscherichia coli S88
Repliconplasmid pECOS88 [GenBank: NC_011747] [Browse all T4SS(s) in this replicon]
Location [Strand]79764..80510 [+]
Productconjugal transfer pilus acetylation protein TraX
Component typeTraX_F
UniProt IDB7LI92
KEGG IDecz:pECS88_0095
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 3.1e-52, Aligned region: 32..247
Protein Sequence: 248 a.a.     [Download]
>gi|218534563|ref|YP_002401093.1| conjugal transfer pilus acetylation protein TraX [Escherichia coli S88]
MTTDNTNTTRNDSLAARTDTWLQSLLVWSPGQRDIIKTVALVLMVLDHANRILHLDQTWMFLAGRGAFPL
FALVWGLNLSRHAHIRQSAINRLWGWGIIAQFAYYLAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAA
AILLMALWGPLSGTSYGIAGLLMLAVSHRLYRAEDRTERLALVACLLAVIPALNLATSDAAAVAGLVMTV
LTVGLVSCAGKSLPRFWPGDFFPTFYACHLAVLGVLAL
 
Nucleotide Sequence: 747 bp     [Download]
>gi|218534477|ref|NC_011747.1|:79764-80510 Escherichia coli S88 plasmid pECOS88, complete sequence
ATGACAACGGATAACACGAACACGACACGTAACGATTCACTGGCTGCCCGGACCGATACCTGGTTGCAGT
CGTTGCTGGTCTGGTCACCCGGACAGCGGGATATCATCAAAACGGTGGCACTGGTGCTGATGGTACTGGA
CCACGCAAACCGCATTCTGCATCTGGACCAGACGTGGATGTTTCTGGCCGGGCGTGGAGCCTTTCCGTTG
TTTGCTCTGGTGTGGGGGCTGAATCTGTCCCGCCATGCGCATATCAGGCAGTCGGCCATTAACCGGCTGT
GGGGATGGGGAATTATTGCCCAGTTCGCGTATTATCTGGCAGGCTTTCCGTGGTATGAGGGGAATATCCT
GTTTGCCTTTGCAGTGGCGGCACAGGTGCTGACGTGGTGTGAAACGCGCAGTGGGTGGCGTACAGCAGCG
GCCATTCTCCTGATGGCACTGTGGGGACCTTTGTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGC
TGGCAGTCAGCCACCGGCTGTACCGGGCGGAAGACAGAACGGAACGTCTGGCGCTGGTTGCATGCCTGCT
GGCTGTTATTCCGGCGCTTAACCTTGCCACCAGTGATGCCGCGGCGGTGGCCGGCCTTGTGATGACGGTG
CTGACCGTTGGTCTGGTGTCCTGTGCAGGGAAATCATTACCCCGTTTCTGGCCCGGAGATTTTTTCCCGA
CGTTCTATGCCTGTCATCTGGCTGTGCTGGGCGTTCTGGCGCTGTAA
 Primer design