SecReT4
Protein ID: 218534617
T4SS name [ID]Tra_I [182]
Gene symbol-
Locus tagpGDT4_0002
StrainYersinia pseudotuberculosis plasmid pGDT4 (NC_011759)
Repliconplasmid pGDT4 [GenBank: NC_011759] [Browse all T4SS(s) in this replicon]
Location [Strand]3657..4088 [+]
ProductTraL protein
Component typeTraL_I
UniProt IDB7UEZ3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 143 a.a.     [Download]
>gi|218534617|ref|YP_002424379.1| TraL protein [Yersinia pseudotuberculosis]
MKKSCNLLLCALLLTATMSSQAATCRAYSAAQVGSQSGYDRAKKAADAWSEREDQATDALQQCLGDISTS
ITMPTFPNLADILNGIKDKICAAARDKISDYIPSNIDPWGDLSVSDYSIPTTSVPVSRSAVPTTNSSSPF
NLN
 
Nucleotide Sequence: 432 bp     [Download]
>gi|218534615|ref|NC_011759.1|:3657-4088 Yersinia pseudotuberculosis pGDT4 plasmid
ATGAAAAAATCGTGCAATTTACTGCTCTGTGCTCTGTTGCTGACAGCCACTATGTCCAGTCAAGCCGCAA
CTTGTCGCGCTTACAGCGCCGCTCAAGTGGGCAGTCAGTCGGGATATGACCGAGCAAAGAAAGCCGCTGA
TGCCTGGTCAGAACGAGAGGATCAGGCAACTGATGCACTCCAGCAATGTCTCGGGGATATCAGTACGTCA
ATAACCATGCCGACGTTCCCTAATTTGGCCGATATTTTGAATGGGATAAAAGACAAGATTTGTGCCGCTG
CCCGCGACAAAATTTCTGACTATATCCCCAGCAATATTGACCCTTGGGGGGATTTGAGTGTGTCAGACTA
CTCTATCCCCACAACCTCCGTTCCGGTTTCACGCAGCGCCGTCCCGACGACCAATAGCAGTTCGCCCTTC
AATCTCAACTAA
 Primer design