SecReT4
Protein ID: 218534618
T4SS name [ID]Tra_I [182]
Gene symbol-
Locus tagpGDT4_0003
StrainYersinia pseudotuberculosis plasmid pGDT4 (NC_011759)
Repliconplasmid pGDT4 [GenBank: NC_011759] [Browse all T4SS(s) in this replicon]
Location [Strand]4133..4816 [+]
ProductTraM protein
Component typeTraM_I
UniProt IDB7UEZ4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 2.2e-31, Aligned region: 77..183
Protein Sequence: 227 a.a.     [Download]
>gi|218534618|ref|YP_002424380.1| TraM protein [Yersinia pseudotuberculosis]
MIMKKRPGPAGAGNSVPAPYQAAFLLHQQNQLGASVARSALKLNIMLSAALLISLIVILGLSWKVAHPPV
KYFATVNGRVVEIFPTDQPAYSQDEVTEFGAATIRKAFTLDFVHYKQQMNAVSDRFSREGYISYYNALTA
SNVLSSITGKKMNLSPSVEPGVVRTKGLLDNGVYAWEIQYPVSLRLEGQTNSLPAQRFIFSVFIQRADVT
DKPDGLEVTQLVTLEPQ
 
Nucleotide Sequence: 684 bp     [Download]
>gi|218534615|ref|NC_011759.1|:4133-4816 Yersinia pseudotuberculosis pGDT4 plasmid
TTGATAATGAAAAAACGTCCCGGCCCTGCCGGTGCGGGCAACAGTGTGCCTGCACCTTATCAAGCCGCAT
TCCTGTTACATCAACAAAATCAACTGGGTGCCAGTGTTGCCCGTAGCGCCCTGAAACTGAATATCATGTT
AAGTGCTGCTCTATTGATCTCACTAATCGTTATCCTCGGGCTGAGCTGGAAGGTGGCACATCCTCCGGTT
AAATACTTCGCCACGGTAAATGGAAGGGTTGTGGAAATTTTCCCGACAGACCAACCCGCGTATAGCCAGG
ATGAAGTCACTGAATTTGGTGCGGCAACCATCCGCAAAGCATTCACACTCGATTTTGTCCATTACAAGCA
ACAAATGAACGCCGTCTCTGACCGATTCTCAAGAGAAGGGTATATCAGCTACTACAACGCATTAACCGCG
TCCAACGTACTGAGCTCAATAACCGGTAAGAAAATGAACCTGTCGCCCTCGGTTGAACCCGGCGTCGTAA
GGACCAAAGGGCTACTCGATAATGGGGTCTATGCCTGGGAAATTCAGTACCCCGTGTCCCTGAGGCTGGA
GGGGCAAACCAACTCACTTCCGGCACAGCGATTCATCTTCTCAGTATTTATCCAACGTGCTGACGTCACG
GATAAACCTGACGGTTTAGAGGTCACTCAACTGGTGACGTTAGAACCTCAATAA
 Primer design