SecReT4
Protein ID: 218534626
T4SS name [ID]Tra_I [182]
Gene symbol-
Locus tagpGDT4_0011
StrainYersinia pseudotuberculosis plasmid pGDT4 (NC_011759)
Repliconplasmid pGDT4 [GenBank: NC_011759] [Browse all T4SS(s) in this replicon]
Location [Strand]10239..13313 [+]
ProductTraU protein
Component typeTraU_I
UniProt IDB7UF02
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 2.3e-61, Aligned region: 505..906
Protein Sequence: 1024 a.a.     [Download]
>gi|218534626|ref|YP_002424388.1| TraU protein [Yersinia pseudotuberculosis]
MIVEKILNAVESAIANTSRYTLGRDFTAYCDLRTTLGLTDEDRALRPELQAPYIFVTHPGDYASVYEIQG
AFCEFDEQNALTETEKKENTYSFNHYISRLHTSLASEFKTLGHKLSFVFERDPGKAREELNRLFAPQFRA
IRRLGIDIDDIIQEKIDKLTPYAARERAFLVVYTGLISLPGAELKSDQKRLNKQLEGAPVARYGQNPELY
RLEGLKMRHDALVSKIQSDFSTDGQGVLLRLMDAHEVGFSIREEVDRNGTASDWRPFLPGDVLFPHGSPK
GDDFSGLLAPHLNYQLFSQETNTQGNLVEIDGMWHTSLAVTLGPQKPETFTQLFNKVNRKVPFRVRFDLM
PGGQEILGKKRTALGFLAVISSLRPIYESVEWLAKNNENDPTCVMTISASTWAETESDVKRNITMLQKAF
QSWGVCEVTRTFGDPLRAWVNSIVGAATAGGANLLFPPLSAALAMLPLQRPATPWTNDANVVWLTLDGKL
FPVRLGSSLQEKHTEIAAGEPGSGKSVLINVLNEVVITNGQTHLPFLSVIDKGYGAQGLIRMIRECLPPE
RQDEAVGIVLQNDAHYCRNPFDIQLGARYPLIPERAWLINILYALCIDPSKGNPPNPKDTRQILGRVIDE
AYRNNAEKSPIRYAPSWVPSVDTALVSSGLRSLHSNHEWEEFSWYEVRDMLFEKGFIAEAMKAQYQAVPE
LSDLQIWLNHDDVRSAFGKVNRDGSQEPLLEYISRCLTQAGTEYRMLSGRTQFALNPNTRVVAIDLNNVM
GDDSDEGHLRTGIMYLFAGQVASGDYILPQYADELISKINPHYKDFHLARIEQLDQELKTKGYDELHNAQ
KVPFIFSALETQDREQRKFAIRTVLSSQYLSDFPENLLKSANSLYLMRIRPEDAKILTEHFQVPPATIRR
FMNSSKGAAADGSGTSFLAVFKTKVGRIAQILKNTVGPRELWALNSTPKDSALRNLMYEQLDGRTAREIL
AENFPTGSAEKLIELRQKQAGENDHANIIRRLADELIASRGFRL
 
Nucleotide Sequence: 3075 bp     [Download]
>gi|218534615|ref|NC_011759.1|:10239-13313 Yersinia pseudotuberculosis pGDT4 plasmid
ATGATCGTTGAAAAAATCCTGAATGCGGTTGAATCGGCCATTGCCAACACGTCTCGCTACACGCTAGGCC
GTGACTTTACGGCCTATTGCGACCTGCGGACCACCCTCGGTTTAACGGATGAAGATCGGGCTCTACGACC
CGAACTGCAAGCCCCATATATTTTTGTCACTCACCCCGGTGATTACGCCAGCGTGTATGAAATTCAGGGC
GCATTTTGTGAGTTTGACGAACAGAATGCCCTCACGGAAACAGAAAAAAAAGAGAACACCTATTCTTTCA
ATCACTACATATCACGCCTTCATACCTCACTTGCCAGTGAGTTCAAAACATTGGGCCATAAACTCAGTTT
TGTCTTTGAGCGAGATCCAGGTAAAGCACGCGAAGAGTTAAACCGCCTGTTTGCACCACAATTCCGGGCT
ATACGTCGGTTGGGTATCGATATTGACGACATCATCCAAGAGAAAATCGACAAACTGACGCCCTACGCCG
CTCGCGAACGGGCCTTCCTGGTTGTCTATACCGGATTGATTTCTCTCCCGGGAGCCGAATTAAAGAGCGA
CCAAAAGCGACTGAACAAACAGCTTGAAGGGGCTCCCGTTGCACGTTATGGCCAGAATCCAGAGTTGTAT
CGACTCGAAGGCCTGAAAATGAGACACGATGCCCTGGTCAGTAAGATACAAAGTGACTTTTCTACTGATG
GTCAGGGCGTGTTGTTACGCCTGATGGACGCACATGAAGTCGGGTTCAGTATCCGGGAAGAAGTTGACCG
TAATGGCACGGCATCTGACTGGCGTCCATTTTTACCCGGTGATGTGCTGTTCCCCCATGGGAGCCCAAAA
GGGGACGACTTCTCCGGCCTGCTAGCTCCCCACCTGAATTATCAATTGTTTTCTCAGGAAACGAACACTC
AGGGCAATCTGGTTGAAATCGATGGCATGTGGCACACCAGTTTAGCGGTCACTCTTGGGCCACAAAAGCC
GGAGACGTTTACCCAACTGTTTAATAAAGTGAACCGTAAAGTCCCCTTCAGAGTACGTTTTGACCTGATG
CCTGGCGGGCAAGAGATCTTGGGGAAAAAACGGACCGCGCTCGGTTTTTTGGCCGTTATTTCCTCTCTTC
GCCCTATCTATGAGTCCGTAGAATGGCTGGCCAAAAACAATGAGAATGACCCGACCTGTGTGATGACCAT
TTCCGCCAGTACCTGGGCAGAAACCGAATCCGATGTGAAGCGCAACATCACCATGTTGCAGAAAGCCTTT
CAGTCATGGGGAGTGTGCGAGGTCACACGGACGTTTGGTGATCCTTTACGGGCTTGGGTAAATTCAATTG
TAGGTGCGGCTACTGCAGGAGGGGCCAACTTGCTGTTCCCTCCGTTGTCCGCTGCACTGGCAATGCTACC
GCTGCAACGTCCTGCCACCCCCTGGACTAACGACGCCAATGTCGTTTGGTTGACATTGGACGGTAAATTA
TTTCCCGTCCGACTGGGGAGTTCATTGCAAGAGAAACACACTGAAATCGCAGCCGGTGAACCGGGTTCCG
GTAAGTCTGTATTAATCAACGTACTAAACGAAGTGGTCATCACTAACGGTCAAACACACCTGCCATTCCT
CAGTGTGATAGATAAAGGTTACGGCGCACAAGGGCTGATACGGATGATCCGTGAATGCCTTCCACCAGAA
CGCCAGGATGAAGCAGTCGGTATCGTATTGCAAAATGATGCCCATTATTGCCGTAATCCGTTCGATATCC
AACTGGGTGCTCGTTATCCTTTGATACCTGAGCGTGCCTGGTTAATAAACATTCTCTATGCGCTGTGTAT
TGACCCCAGCAAGGGAAATCCGCCCAATCCCAAGGATACTCGTCAGATCCTCGGGCGGGTTATCGATGAA
GCCTACCGGAATAATGCCGAAAAGAGCCCTATTCGATATGCCCCATCTTGGGTACCAAGCGTAGATACTG
CACTCGTCAGCAGCGGATTACGCTCACTACACTCAAACCATGAATGGGAAGAATTTTCCTGGTATGAAGT
ACGCGACATGCTGTTTGAAAAGGGGTTTATTGCTGAGGCGATGAAAGCACAATACCAGGCCGTTCCCGAA
CTCTCAGACCTGCAAATTTGGCTCAATCATGACGATGTGCGCAGTGCTTTCGGGAAGGTTAATCGCGATG
GTTCACAAGAACCGTTGCTGGAGTACATATCCCGCTGCTTAACCCAAGCGGGGACAGAGTACCGCATGCT
ATCAGGCCGCACTCAGTTTGCTTTAAACCCGAATACCCGGGTCGTGGCCATTGACCTCAACAACGTGATG
GGGGATGACTCCGATGAGGGCCATCTGCGAACCGGTATTATGTACTTGTTTGCCGGTCAGGTGGCATCGG
GAGATTACATTCTGCCGCAATACGCTGATGAACTGATCAGTAAAATTAACCCGCACTACAAAGATTTCCA
TTTGGCGAGGATTGAGCAACTGGACCAGGAGCTCAAAACCAAAGGTTATGACGAGCTGCACAATGCTCAG
AAAGTACCTTTCATTTTCAGTGCACTGGAAACACAGGACCGTGAACAACGTAAGTTTGCAATTCGTACCG
TTTTGTCATCGCAATACTTGTCTGATTTCCCCGAAAACTTATTGAAATCCGCAAACTCACTTTACCTAAT
GCGTATTCGCCCGGAAGACGCAAAGATCCTAACAGAGCATTTTCAGGTCCCTCCAGCCACCATCCGGCGT
TTTATGAACAGCAGTAAAGGCGCTGCAGCGGATGGCAGTGGTACCAGCTTTCTGGCGGTATTTAAAACCA
AAGTGGGCCGTATTGCCCAAATCCTCAAAAACACCGTCGGTCCCCGCGAACTCTGGGCGCTTAACTCAAC
GCCTAAAGACAGCGCACTTCGTAACCTGATGTATGAACAGCTCGATGGCCGTACTGCTCGCGAAATCCTG
GCAGAAAACTTTCCTACCGGCAGTGCTGAAAAACTCATTGAGCTGAGGCAAAAGCAGGCTGGGGAAAACG
ACCACGCCAATATCATTCGCCGACTGGCTGACGAACTTATTGCCTCACGCGGCTTTCGTTTGTAA
 Primer design