SecReT4
Protein ID: 218534714
T4SS name [ID]Tra_I [182]
Gene symbol-
Locus tagpGDT4_0100
StrainYersinia pseudotuberculosis plasmid pGDT4 (NC_011759)
Repliconplasmid pGDT4 [GenBank: NC_011759] [Browse all T4SS(s) in this replicon]
Location [Strand]92443..93609 [+]
ProductTraJ protein
Component typeTraJ_I
UniProt IDB7UF42
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.6e-33, Aligned region: 26..307
AAA_23 [PF13476], Evalue: 3.9e-06, Aligned region: 149..179
Protein Sequence: 388 a.a.     [Download]
>gi|218534714|ref|YP_002424476.1| TraJ protein [Yersinia pseudotuberculosis]
MSDKRLVPFDFSGGLTADSLRNFFTWCARNDVSDIHLQGGNHIIVSRFGRLLKVSEFRVEDAQLTKWIDE
VFTPEVKAMVKSGKGVDRPLQLDGDANQRYGLNRGERLRFRANFIQATIGRQELTTAVTLRILPTVIPAL
ETLGLEDELKLNLLPHKGLILVCGETGSGKSTLLASIYQYCGRLYPDRKIVTFEDPIEYILATPDNVLPP
TQSQIRRDVPSFAEGLRLALRQAPDLIGVGEIRDLETILGAIACGQSGHLCLSTMHTHSPGETIPRAVLM
FPPEMREAAARDILGVIQVIVVQRLLRTTDGKRQAIREYLVFNEEIRHELAGLNYTLWGNWIDSHLQSKQ
ATIVDAAWHLYQEGRIDRVEMLTVVSPGQLLTLETLPV
 
Nucleotide Sequence: 1167 bp     [Download]
>gi|218534615|ref|NC_011759.1|:92443-93609 Yersinia pseudotuberculosis pGDT4 plasmid
ATGTCGGATAAAAGACTTGTTCCCTTTGATTTCTCTGGGGGGCTTACCGCTGATAGCTTGCGCAATTTCT
TTACCTGGTGTGCGAGAAATGATGTTTCGGATATTCATTTGCAGGGTGGTAATCACATCATTGTGAGTCG
ATTTGGTCGTTTACTGAAAGTCAGTGAGTTTCGCGTCGAAGATGCCCAGCTAACCAAATGGATTGATGAG
GTATTTACGCCAGAAGTAAAAGCGATGGTCAAGTCAGGCAAAGGGGTTGACCGACCTCTCCAGCTCGATG
GGGATGCGAATCAACGTTATGGACTGAACCGAGGTGAGCGCCTGCGGTTTCGAGCCAATTTTATTCAAGC
GACAATTGGCCGACAAGAACTGACGACGGCCGTTACACTCCGGATCCTCCCCACTGTCATCCCTGCCTTA
GAAACGCTGGGTTTGGAAGATGAGTTAAAGCTCAATCTACTCCCGCACAAAGGCCTTATTCTGGTGTGCG
GTGAGACGGGGTCAGGTAAATCAACCCTTCTGGCGTCAATCTATCAGTATTGTGGACGGTTATATCCTGA
TAGAAAAATTGTCACTTTCGAAGATCCAATAGAATACATTCTCGCGACACCCGATAACGTGTTACCGCCG
ACTCAATCCCAAATTCGTCGAGATGTTCCCAGCTTTGCGGAAGGATTACGTCTGGCGCTACGACAAGCGC
CGGATTTGATTGGTGTGGGGGAAATACGTGATCTGGAAACGATCCTCGGTGCCATTGCCTGTGGTCAGTC
AGGGCATTTATGTTTGTCTACCATGCACACCCATTCCCCAGGCGAAACGATCCCCCGCGCCGTTCTGATG
TTCCCCCCGGAAATGCGTGAAGCGGCAGCCCGAGATATTCTCGGTGTTATTCAGGTCATTGTGGTGCAGC
GACTGTTACGTACTACTGACGGTAAACGTCAGGCCATCAGGGAATACCTGGTCTTTAATGAAGAAATTCG
TCATGAACTGGCCGGTTTGAATTACACCCTATGGGGTAACTGGATTGACAGTCATCTCCAGTCAAAGCAA
GCCACCATCGTCGATGCTGCCTGGCACTTATATCAGGAAGGTCGTATTGATCGCGTAGAAATGCTCACCG
TTGTCAGCCCTGGTCAGCTATTGACGTTAGAAACCCTGCCTGTCTGA
 Primer design