SecReT4
Protein ID: 218666648
T4SS name [ID]Trb [792]
Gene symbol-
Locus tagAFE_1695
StrainAcidithiobacillus ferrooxidans ATCC 23270
Repliconchromosome [GenBank: NC_011761] [Browse all T4SS(s) in this replicon]
Location [Strand]1467443..1468588 [+]
Productconjugal transfer protein
Component typeTrbG
UniProt IDB7JB34
KEGG IDafr:AFE_1695
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.9e-24, Aligned region: 140..379
Protein Sequence: 381 a.a.     [Download]
>gi|218666648|ref|YP_002426117.1| conjugal transfer protein [Acidithiobacillus ferrooxidans ATCC 23270]
MKTKTWLSLGLAVLPGLALAGVDTGLPAVKPIGSLQGKPPIQPAGTKTGSAHPSTTPSASGGTTSARQKV
PAISPEAAERIAAVQVWQQSIATPPEGPESAATRALARQSLTASQAMDNTLPVVGGANGTVDSLAGRPVL
VCSPLHTCIIELPDGVRPVTTVGVSKSEWNVQQALVGKQPEIFLSPKFKGLHQNIVVAATDQSRPINYEI
RLVSDAVRYIPALKIEDSGGEVRSWKTDLQSADSQAADSQAAALLTADNAPTDQSAADHKGNVLPLPNIR
LNHVNLRWSIHCGGGGWFRSSDCKPIRPLRVYDDGTHTFIDMPQGLASHGGFPILQARNASGHLIGVDTQ
IRGNTYVVDSVPAEILLRLGSEVVTIQQEGR
 
Nucleotide Sequence: 1146 bp     [Download]
>gi|218665024|ref|NC_011761.1|:1467443-1468588 Acidithiobacillus ferrooxidans ATCC 23270 chromosome, complete genome
ATGAAAACCAAGACATGGCTTTCTTTGGGGCTCGCCGTCCTTCCTGGATTGGCGTTGGCTGGCGTAGATA
CTGGACTCCCCGCGGTGAAGCCGATCGGTTCGCTGCAGGGAAAACCGCCAATACAGCCTGCAGGGACGAA
AACCGGTTCCGCCCATCCGTCCACGACACCATCCGCATCTGGCGGCACCACATCTGCGCGCCAGAAGGTC
CCGGCCATCTCCCCGGAGGCTGCCGAGCGGATAGCGGCGGTGCAGGTGTGGCAACAGTCCATCGCCACCC
CGCCCGAGGGCCCAGAAAGTGCTGCAACCAGAGCGTTGGCACGTCAGTCGCTGACGGCGTCCCAGGCAAT
GGATAACACTCTTCCCGTGGTCGGCGGCGCGAACGGAACCGTCGACAGCCTGGCCGGTCGGCCCGTGCTG
GTTTGCTCGCCGCTGCACACCTGCATCATCGAGCTGCCCGACGGTGTCAGGCCCGTGACGACCGTCGGCG
TCAGCAAGTCGGAATGGAATGTGCAGCAGGCGCTGGTTGGGAAACAGCCGGAAATCTTCCTGAGCCCGAA
ATTCAAGGGTCTCCACCAAAACATCGTGGTAGCCGCAACCGACCAGAGCAGGCCCATCAACTATGAAATC
CGTCTGGTCAGTGACGCAGTGCGCTACATTCCCGCCCTGAAGATCGAGGATAGCGGGGGCGAGGTCCGTT
CCTGGAAAACAGACTTGCAGTCAGCAGACTCGCAGGCAGCAGACTCGCAGGCGGCGGCCTTGCTGACGGC
AGACAACGCACCAACGGATCAGTCGGCTGCTGACCATAAAGGCAATGTACTGCCTCTGCCCAATATCCGT
CTCAACCACGTCAATCTTCGCTGGTCCATTCATTGCGGTGGCGGCGGATGGTTCCGTTCCAGCGACTGCA
AACCAATCCGTCCATTGCGCGTGTATGACGATGGGACCCATACCTTCATCGACATGCCTCAGGGGCTGGC
GAGCCACGGAGGCTTTCCCATCCTGCAAGCCCGCAATGCCAGCGGACACCTGATCGGAGTCGATACCCAG
ATCCGGGGCAACACCTATGTCGTCGATTCAGTTCCTGCCGAGATCCTGTTACGGCTGGGTTCTGAGGTGG
TCACCATCCAGCAGGAGGGGAGGTAA
 Primer design