SecReT4
Protein ID: 218666959
T4SS name [ID]Tra_F [558]
Gene symboltraL
Locus tagAFE_1078
StrainAcidithiobacillus ferrooxidans ATCC 23270
Repliconchromosome [GenBank: NC_011761] [Browse all T4SS(s) in this replicon]
Location [Strand]971257..971535 [+]
Producttype IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDB7J826
KEGG IDafr:AFE_1078
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 4.4e-14, Aligned region: 4..78
Protein Sequence: 92 a.a.     [Download]
>gi|218666959|ref|YP_002425550.1| type IV conjugative transfer system protein TraL [Acidithiobacillus ferrooxidans ATCC 23270]
MQPVRIPNHFDDQRQILFWDIDTLAVVIMFFIIGYVLRELTIMMVLAFFAGHLFSKWKTNQLNGVLIHLS
YRFGWWRINDVFKNGNTKEWVD
 
Nucleotide Sequence: 279 bp     [Download]
>gi|218665024|ref|NC_011761.1|:971257-971535 Acidithiobacillus ferrooxidans ATCC 23270 chromosome, complete genome
ATGCAACCCGTGAGGATACCTAATCACTTTGATGACCAGCGCCAGATCCTGTTTTGGGACATCGACACCC
TGGCCGTGGTCATTATGTTTTTCATCATCGGATATGTGCTGCGCGAGTTGACCATCATGATGGTGCTGGC
GTTTTTTGCGGGCCATCTGTTTTCAAAATGGAAGACCAATCAGCTCAATGGAGTTCTGATCCATCTCAGC
TATCGGTTCGGATGGTGGCGCATCAACGATGTTTTCAAAAACGGCAATACGAAGGAGTGGGTCGATTGA
 Primer design