SecReT4
Protein ID: 218667355
T4SS name [ID]Tra_F [558]
Gene symbol-
Locus tagAFE_1066
StrainAcidithiobacillus ferrooxidans ATCC 23270
Repliconchromosome [GenBank: NC_011761] [Browse all T4SS(s) in this replicon]
Location [Strand]958886..959899 [+]
Productpilus assembly protein TraF
Component typeTraF_F
UniProt IDB7J814
KEGG IDafr:AFE_1066
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 3.7e-58, Aligned region: 47..276
Protein Sequence: 337 a.a.     [Download]
>gi|218667355|ref|YP_002425538.1| pilus assembly protein TraF [Acidithiobacillus ferrooxidans ATCC 23270]
MGHCSNQRIHHGNVLAIAVATTFIGLCLSFCGPDVAQANVLSGDTHGWFWYQLPPPPPKPLPPPRPVVQA
PPKPAPVKKVAPKPAGPKVFSVQWIKKTLPKWRNRAINDPSTKNVTQYLALQKVMFDKAQNFAERFVQVA
NTNPVLNYSAIIPRSGAGNTDFQSYLQQNKMRALRYLSKHVGMWVFVKHGCPFCDMQLTQYGNMNQMIHF
ATDYIDVNNGPITGLPKNAVLVQDHGQAKDLHLVETPTIIMIYPPDNFAIIAQGYQVMGSLEDNILADAE
YLHLLPKKLTEWTGANAYERGVLTTAQMKQAQNQKNANPQTITQYIENATASRISNW
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|218665024|ref|NC_011761.1|:958886-959899 Acidithiobacillus ferrooxidans ATCC 23270 chromosome, complete genome
TTGGGCCACTGTAGTAACCAGCGGATTCACCATGGAAATGTCCTTGCGATAGCCGTCGCGACGACGTTTA
TTGGTTTGTGCCTGTCGTTCTGCGGACCCGATGTCGCTCAGGCTAATGTGCTTTCCGGCGACACACACGG
CTGGTTTTGGTACCAATTGCCACCTCCACCGCCCAAGCCACTGCCACCACCCAGACCCGTGGTGCAGGCA
CCGCCAAAACCCGCTCCGGTGAAGAAGGTCGCGCCCAAACCGGCGGGACCGAAGGTCTTTTCGGTGCAGT
GGATTAAAAAAACATTGCCCAAATGGAGAAATCGGGCGATCAACGACCCAAGCACCAAGAATGTCACGCA
ATACTTGGCGTTGCAGAAGGTCATGTTCGATAAGGCCCAGAATTTCGCAGAGCGATTCGTCCAAGTCGCC
AACACGAATCCGGTGCTCAATTATTCCGCGATCATTCCACGATCCGGCGCAGGCAATACGGATTTCCAGT
CCTATTTGCAGCAGAATAAAATGCGGGCACTGCGCTATTTGAGCAAACACGTCGGGATGTGGGTGTTCGT
GAAGCATGGATGCCCGTTTTGCGACATGCAGTTGACGCAGTACGGCAATATGAACCAGATGATCCATTTC
GCTACTGACTATATCGACGTGAATAACGGGCCGATTACGGGTCTACCGAAAAATGCGGTGCTTGTGCAGG
ATCATGGCCAGGCGAAGGATTTGCACCTGGTCGAGACCCCGACCATCATCATGATTTATCCGCCCGATAA
TTTTGCGATTATCGCGCAGGGTTACCAGGTCATGGGCAGCCTCGAGGACAATATCCTGGCGGACGCCGAG
TATCTGCATCTCTTGCCGAAAAAGCTCACGGAATGGACCGGGGCCAATGCATATGAGCGCGGAGTGCTGA
CCACGGCACAGATGAAGCAAGCGCAGAACCAGAAAAACGCGAACCCGCAGACCATTACGCAGTACATCGA
AAACGCCACGGCATCCAGAATCTCAAATTGGTGA
 Primer design