SecReT4
Protein ID: 218667853
T4SS name [ID]Trb [792]
Gene symbol-
Locus tagAFE_1636
StrainAcidithiobacillus ferrooxidans ATCC 23270
Repliconchromosome [GenBank: NC_011761] [Browse all T4SS(s) in this replicon]
Location [Strand]1408788..1409174 [+]
Producthypothetical protein
Component typeTrbC
UniProt IDB7JAX5
KEGG IDafr:AFE_1636
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 8.3e-09, Aligned region: 1..96
Protein Sequence: 128 a.a.     [Download]
>gi|218667853|ref|YP_002426058.1| hypothetical protein AFE_1636 [Acidithiobacillus ferrooxidans ATCC 23270]
MKKRLKAIFSGVRKVSAAGLMVLAPGMAFASTSGGVFSPIAGPLNTVLTGMQDLGGLVAAGGFVATGLSW
WHGGEHKKAMMIGMGATVGGIAMANAKSLATSITGGATMGHVGILGLAASHALHVVGL
 
Nucleotide Sequence: 387 bp     [Download]
>gi|218665024|ref|NC_011761.1|:1408788-1409174 Acidithiobacillus ferrooxidans ATCC 23270 chromosome, complete genome
ATGAAAAAGCGGTTGAAGGCAATATTCTCCGGGGTTCGCAAGGTCAGCGCCGCGGGCCTCATGGTCCTGG
CCCCCGGCATGGCGTTCGCGTCCACATCCGGCGGTGTGTTTTCTCCCATTGCGGGGCCGCTGAATACGGT
CCTGACGGGTATGCAGGATTTGGGCGGGCTGGTCGCCGCTGGCGGCTTCGTCGCGACGGGACTTTCCTGG
TGGCATGGCGGCGAACACAAAAAGGCCATGATGATTGGCATGGGTGCGACGGTCGGGGGCATTGCCATGG
CCAATGCGAAATCGCTCGCCACCAGCATCACCGGCGGCGCCACGATGGGCCATGTGGGCATCCTGGGCCT
CGCCGCATCACACGCGCTGCACGTCGTGGGGCTCTAG
 Primer design