SecReT4
Protein ID: 218667869
T4SS name [ID]Tra_F [558]
Gene symbol-
Locus tagAFE_1047
StrainAcidithiobacillus ferrooxidans ATCC 23270
Repliconchromosome [GenBank: NC_011761] [Browse all T4SS(s) in this replicon]
Location [Strand]943788..945923 [+]
Productrecombinase D
Component typeTraI_F
UniProt IDB7J7Z5
KEGG IDafr:AFE_1047
PDB IDNA
Domain hit(s) vs Pfam AAA_30 [PF13604], Evalue: 1.1e-38, Aligned region: 323..483
UvrD_C_2 [PF13538], Evalue: 4.3e-27, Aligned region: 577..683
AAA_19 [PF13245], Evalue: 5e-16, Aligned region: 328..394
Viral_helicase1 [PF01443], Evalue: 3.7e-10, Aligned region: 340..453
AAA_11 [PF13086], Evalue: 1.4e-08, Aligned region: 411..453
Protein Sequence: 711 a.a.     [Download]
>gi|218667869|ref|YP_002425519.1| recombinase D [Acidithiobacillus ferrooxidans ATCC 23270]
MPEMQTLIGQVTRLIFSGKADSFRIFEVQIKGANKREIVTGEWQRARVGANIEAAGTWEKRKGKDEIQFK
ARSILEIVPTSADSILSWLEGGAVKGIGKVSAKKLVACFGAGLLEILDQHPERIVEAGIGKKQREKIIEG
WKIASATRIIMQFLREVGIGPERSNAVWRQFKDHPAIAGQPAVLVARLRNNPYRLIRVRGIGFSLADQAA
GKLGIRADADYRVDAGIEHTLQTRTEDGHVWTPEPTLLGLCKELLGVSQEKIVARIQVMQEAQQIATELG
APNRFASVRLSRMEISLAAKIRSLSGPAPKKTMRFPAGFVPDPTQIEALNQISDRKLAILAGGPGMGKTT
LLKTCAQSAVASGMRVALCAPTGRAAKRMNEATGMEAKTIHRLLEMKRGGLAERNRDNPIEADWIIVDEV
SMLDMELAWKLFDAIPARARVLLVGDPDQLPSVGPGQVLADLIACGKVTVARLSKIFRQQAGSGIPVMAT
QVIQGVVPNLDPDSSDCPFVDAECIGEESEEATAVVVRRIVQESEKLGSRMQALAPMRNGPLGTLKLNQA
LREAFNPDAGQPHRGRFRLGDWVIQTRNNYDLDVYNGDLGTVVAIEEGDEQAVVVDFEDRVVRYEDNEDL
RDLDHAYCLTIHKSQGGQFPGVAMVATTAHFVMLKRNLLYTGMTRAEKHLLLISTKRALQIACKKSGIEK
RDTLLAQRIGG
 
Nucleotide Sequence: 2136 bp     [Download]
>gi|218665024|ref|NC_011761.1|:943788-945923 Acidithiobacillus ferrooxidans ATCC 23270 chromosome, complete genome
ATGCCCGAAATGCAGACGCTCATCGGCCAGGTCACCCGCCTTATCTTCTCAGGCAAGGCGGATTCCTTTC
GCATTTTTGAGGTGCAGATCAAGGGCGCGAACAAGCGCGAGATTGTCACCGGCGAGTGGCAACGGGCCCG
TGTGGGCGCGAACATCGAAGCGGCGGGAACCTGGGAGAAGCGCAAAGGAAAGGATGAAATTCAGTTCAAA
GCCCGTTCTATTCTGGAAATCGTACCGACAAGCGCCGACAGCATTTTGTCTTGGCTTGAGGGCGGGGCGG
TAAAGGGCATTGGCAAGGTGTCCGCGAAAAAGCTGGTGGCCTGCTTCGGCGCTGGATTGCTGGAGATTCT
GGACCAGCATCCAGAACGGATCGTGGAGGCCGGTATCGGCAAGAAACAGCGCGAAAAGATTATCGAGGGC
TGGAAAATCGCGTCCGCCACCAGAATCATCATGCAGTTTCTTCGGGAAGTCGGGATTGGCCCGGAACGCT
CCAACGCGGTATGGCGCCAGTTCAAGGATCACCCCGCCATCGCTGGCCAGCCGGCGGTGCTGGTGGCCCG
GCTGCGCAACAACCCCTATCGCCTGATCCGCGTGCGCGGCATCGGGTTCTCGTTGGCCGACCAGGCGGCC
GGCAAACTGGGCATTCGCGCCGACGCGGATTATCGGGTGGACGCGGGGATCGAGCACACTCTGCAAACTC
GCACCGAAGACGGTCACGTTTGGACTCCCGAGCCGACGTTGCTGGGCCTTTGCAAAGAATTGCTGGGCGT
CAGCCAGGAAAAGATCGTGGCGCGCATCCAGGTGATGCAGGAAGCACAGCAGATCGCGACTGAACTGGGC
GCGCCTAATCGCTTCGCCAGCGTACGTCTTTCCAGAATGGAAATTTCCCTGGCGGCCAAGATTCGCTCCC
TGTCTGGTCCGGCGCCCAAGAAAACGATGCGCTTCCCCGCCGGATTCGTTCCGGATCCCACGCAAATCGA
GGCGCTGAACCAGATCAGCGATCGCAAGCTGGCGATTCTGGCCGGCGGGCCAGGCATGGGAAAGACCACC
CTACTCAAGACCTGCGCACAGTCGGCAGTGGCGAGCGGCATGAGGGTTGCTCTTTGCGCCCCAACCGGCC
GTGCGGCCAAACGCATGAACGAGGCGACGGGCATGGAGGCCAAGACCATTCATCGGCTGTTGGAGATGAA
GAGGGGTGGGCTGGCGGAGCGTAATCGGGACAACCCTATCGAAGCGGACTGGATCATCGTGGACGAGGTC
TCCATGCTGGATATGGAGTTGGCCTGGAAGCTGTTTGACGCCATTCCGGCCCGTGCCCGCGTGCTGCTGG
TCGGCGATCCGGACCAGTTGCCTTCCGTGGGCCCCGGGCAAGTTCTGGCCGATCTCATTGCCTGCGGCAA
GGTTACGGTGGCCAGGTTGAGCAAGATCTTCCGGCAGCAAGCCGGGTCCGGTATTCCGGTGATGGCCACC
CAGGTCATTCAGGGCGTCGTGCCGAACCTGGATCCCGATTCGTCGGATTGTCCGTTCGTGGATGCAGAAT
GCATCGGGGAAGAAAGCGAGGAGGCGACAGCGGTGGTGGTGCGGCGCATCGTCCAAGAGTCGGAAAAACT
GGGCAGCCGCATGCAGGCGCTGGCGCCCATGCGGAACGGTCCGCTGGGCACGCTGAAGCTCAACCAGGCC
TTGCGTGAGGCGTTCAACCCGGATGCCGGGCAGCCGCACCGGGGCCGGTTCCGGCTGGGGGACTGGGTAA
TTCAGACGCGCAACAACTACGACCTGGATGTCTATAACGGCGATCTGGGTACCGTGGTGGCCATAGAGGA
GGGCGACGAACAGGCCGTGGTGGTGGATTTCGAGGATCGCGTCGTCCGCTATGAGGATAATGAGGACTTG
CGGGATCTTGATCACGCGTATTGCCTGACCATCCACAAGTCCCAGGGTGGCCAGTTTCCCGGGGTCGCCA
TGGTGGCCACTACCGCGCACTTTGTCATGCTCAAGCGCAATCTGCTGTACACGGGCATGACGCGGGCCGA
GAAGCATCTGCTGCTGATCTCGACGAAAAGGGCCCTGCAGATCGCGTGTAAGAAATCCGGCATTGAGAAG
CGGGACACGCTGTTGGCCCAGAGGATCGGCGGATGA
 Primer design