SecReT4
Protein ID: 218667889
T4SS name [ID]Trb [792]
Gene symbol-
Locus tagAFE_1642
StrainAcidithiobacillus ferrooxidans ATCC 23270
Repliconchromosome [GenBank: NC_011761] [Browse all T4SS(s) in this replicon]
Location [Strand]1413442..1415211 [+]
Productconjugal transfer protein trbL
Component typeTrbL
UniProt IDB7JAY1
KEGG IDafr:AFE_1642
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.2e-16, Aligned region: 72..309
Protein Sequence: 589 a.a.     [Download]
>gi|218667889|ref|YP_002426064.1| conjugal transfer protein trbL [Acidithiobacillus ferrooxidans ATCC 23270]
MRGHRRFPWVMGMLLGAFPGISFAAGSGSLSQVQSLLRGKILPWQSVMQTAATDLFYVLAAVEFSVLFLN
HVLQKRGHEDLFAGIIKKVVTLGFFLTLLDNSGTWIPDIINGLAGGAHALGVTAVTPGQIATEALQAFLG
IVLSPIAAATHNLGNTFSDIFSGNFSAAFSSAGKAVASSNPASLLVETLLAGIIGLLAGVGILVMALEFL
MVQIESYLVIALGVIMLAGGGLRWTAKYVGSYFDYAINVGVRLFILTALAYLVTYSIVPLIQTILENVTN
PLQAGFEVLILGALIALLPRKASSIASSLLSGNSSFSGGELAKEGGMIAGGTVALGAAGVGLAAAAGGGL
AAGGLSAAAGAGGGAAGGAGSLAGGLTGAAGAGETGAAAGVAAPEAGAMSASGGASSGAGAGNAVLAPGM
GGSAGSEAPQAARAVQAPAPITQSTGQQNPSKGVEAPSQETVKEAGQDKRNDQEMSASEPFAGGEPQPDA
PPVPVNAVPAPEPVSAPSGGGGQGSTAAPAPGAAVSGGATMDDVVEQLKQMQGQPKGVADRIKKGFAGRF
LKHVEEITTAKSNQVQKNAIDSSHPRDFD
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|218665024|ref|NC_011761.1|:1413442-1415211 Acidithiobacillus ferrooxidans ATCC 23270 chromosome, complete genome
ATGCGTGGACACCGCAGGTTTCCGTGGGTCATGGGCATGCTTCTGGGTGCCTTCCCCGGCATTTCGTTCG
CAGCGGGTTCGGGATCGTTGAGTCAGGTGCAAAGCCTTTTGCGAGGCAAAATTCTTCCCTGGCAAAGTGT
CATGCAAACGGCGGCCACGGATCTGTTCTACGTCCTGGCGGCGGTCGAGTTCTCCGTCCTGTTTCTGAAC
CATGTTCTGCAAAAGCGTGGGCACGAAGATCTCTTTGCCGGTATCATCAAGAAGGTGGTGACGCTGGGGT
TTTTCCTGACCCTGCTCGACAACTCCGGGACCTGGATTCCCGACATCATCAATGGTCTGGCCGGTGGAGC
GCACGCGCTTGGCGTGACGGCCGTGACACCCGGGCAGATCGCGACGGAGGCTCTTCAGGCATTTCTCGGG
ATCGTGCTGTCTCCAATAGCTGCCGCGACCCACAACCTGGGCAATACCTTCAGCGACATTTTCAGTGGTA
ACTTCTCTGCGGCTTTTTCTTCTGCGGGCAAAGCGGTCGCCAGCAGCAACCCGGCATCGCTCCTGGTAGA
GACCCTCCTGGCGGGGATCATTGGCCTACTGGCGGGCGTGGGCATTCTGGTCATGGCCCTGGAGTTTCTG
ATGGTCCAGATCGAGAGTTACCTGGTGATCGCCCTGGGCGTGATCATGCTGGCCGGCGGCGGGCTGCGCT
GGACGGCCAAGTATGTCGGCAGTTATTTCGATTACGCCATCAACGTGGGTGTCCGTCTTTTTATCCTGAC
CGCGCTGGCGTATCTGGTGACCTACAGCATCGTGCCGCTGATCCAGACGATCCTGGAGAATGTCACGAAT
CCTTTGCAGGCTGGATTCGAGGTGCTTATTCTGGGCGCCCTCATCGCCCTGTTGCCCCGCAAGGCATCCA
GCATTGCCAGTAGCCTCCTGTCCGGTAACTCATCCTTCTCCGGCGGAGAACTGGCCAAGGAAGGCGGGAT
GATCGCTGGTGGTACGGTAGCACTGGGAGCGGCTGGCGTGGGCCTGGCCGCCGCTGCGGGCGGGGGGCTT
GCCGCTGGTGGACTCTCCGCGGCGGCGGGTGCTGGAGGCGGTGCTGCCGGAGGGGCTGGCAGTCTTGCAG
GCGGCCTTACCGGGGCGGCGGGCGCGGGAGAAACCGGCGCGGCGGCTGGTGTGGCGGCACCGGAAGCTGG
GGCGATGTCCGCAAGCGGTGGCGCGAGTTCCGGCGCGGGCGCAGGGAACGCCGTACTGGCCCCCGGCATG
GGTGGTTCGGCGGGTAGTGAGGCTCCACAGGCAGCCAGGGCTGTGCAGGCTCCAGCGCCCATTACGCAAT
CCACTGGCCAGCAAAACCCATCCAAGGGTGTCGAGGCGCCGAGCCAGGAAACTGTAAAGGAAGCGGGCCA
GGATAAGCGGAACGATCAGGAAATGAGTGCAAGCGAACCCTTCGCAGGGGGCGAACCCCAGCCCGACGCG
CCGCCCGTCCCGGTCAATGCGGTTCCGGCGCCAGAACCCGTCAGCGCGCCTTCCGGCGGTGGCGGTCAGG
GAAGCACGGCGGCTCCGGCTCCGGGTGCGGCCGTGAGTGGCGGTGCCACGATGGACGATGTGGTCGAGCA
GCTGAAACAGATGCAGGGGCAGCCCAAGGGAGTGGCGGATAGGATCAAAAAAGGTTTTGCCGGTAGATTT
CTAAAACATGTGGAGGAAATAACTACGGCAAAATCAAATCAAGTCCAGAAGAACGCCATAGATTCCAGTC
ACCCAAGAGATTTTGATTGA
 Primer design