SecReT4
Protein ID: 218668066
T4SS name [ID]Trb [792]
Gene symboltrbB
Locus tagAFE_1634
StrainAcidithiobacillus ferrooxidans ATCC 23270
Repliconchromosome [GenBank: NC_011761] [Browse all T4SS(s) in this replicon]
Location [Strand]1406427..1407395 [+]
ProductP-type conjugative transfer protein TrbB
Component typeTrbB
UniProt IDB7JAX3
KEGG IDafr:AFE_1634
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.8e-78, Aligned region: 29..300
AAA_16 [PF13191], Evalue: 1.7e-05, Aligned region: 146..216
DEAD [PF00270], Evalue: 1.9e-05, Aligned region: 141..197
AAA_19 [PF13245], Evalue: 2.9e-05, Aligned region: 153..194
AAA_10 [PF12846], Evalue: 3.3e-05, Aligned region: 155..193
Protein Sequence: 322 a.a.     [Download]
>gi|218668066|ref|YP_002426056.1| P-type conjugative transfer protein TrbB [Acidithiobacillus ferrooxidans ATCC 23270]
MNIHAHDQQEQQAHARRIEQMRRILGLEIAALFDDTGVVEIMANPDGRVFVERLGSGISPLGEIDASRVQ
SLLGLMADYLHTTVSRDRPIVEGAMPIEFLRSRFAGAIPPLVEGASFSIRLPARSVYTLDQYVEAGIITA
AQMDTLSDAVLSRKNILVSGGTGSGKTTLANALIDRISKLSDIGTRIVIIEDTRELQCTAPNVIQFLTDD
DAGIDMTRLLKLTLRYRPDRILVGEVRDKAALALLKAWNTGHPGGIATLHANNPEAALLRLDQLCQEAGV
PAQQTLIHEAVDIVLQIARDPNHPAGRRISAILNVKDGVLIS
 
Nucleotide Sequence: 969 bp     [Download]
>gi|218665024|ref|NC_011761.1|:1406427-1407395 Acidithiobacillus ferrooxidans ATCC 23270 chromosome, complete genome
GTGAACATCCACGCGCACGATCAGCAGGAACAGCAGGCCCATGCCCGCCGGATCGAGCAGATGCGGCGCA
TTCTGGGGCTGGAGATCGCCGCCCTGTTCGATGACACTGGCGTCGTCGAGATTATGGCCAACCCCGACGG
ACGGGTCTTCGTCGAGCGTCTGGGGTCGGGAATATCCCCCCTGGGCGAGATCGATGCGAGCCGAGTCCAG
TCCCTGCTGGGGCTCATGGCTGACTACCTGCATACCACGGTGAGCCGTGACCGGCCCATCGTCGAGGGGG
CCATGCCCATCGAGTTCCTGCGCAGCCGCTTTGCCGGCGCGATTCCGCCCCTGGTGGAGGGCGCGTCTTT
CAGTATCCGCCTGCCGGCCCGTTCGGTGTACACCCTCGATCAGTACGTTGAGGCGGGCATCATCACGGCG
GCGCAGATGGACACCCTCTCCGATGCCGTGCTTTCCCGCAAGAATATCCTGGTGAGCGGTGGCACAGGAT
CCGGCAAGACCACCCTGGCCAACGCCCTCATCGACAGGATCTCCAAACTATCCGATATCGGCACCCGCAT
CGTGATTATCGAAGATACCCGGGAGCTCCAATGCACCGCTCCCAATGTGATCCAGTTCCTGACCGACGAT
GATGCGGGCATCGACATGACGCGCCTCTTAAAGCTCACGTTGCGCTATCGGCCCGACCGCATACTGGTGG
GCGAGGTCCGCGACAAGGCGGCCCTGGCGCTGCTCAAAGCCTGGAATACGGGACATCCGGGCGGCATCGC
CACCCTGCACGCCAACAACCCCGAAGCGGCCTTGTTGCGTTTGGACCAGCTCTGCCAGGAAGCGGGTGTT
CCCGCGCAGCAGACGCTGATCCATGAGGCGGTGGATATCGTTTTGCAGATTGCCCGTGACCCGAATCATC
CTGCTGGTCGCAGGATTTCGGCCATCCTCAATGTGAAAGACGGCGTGCTGATCTCGTGA
 Primer design