SecReT4
Protein ID: 218689988
T4SS name [ID]VirB [402]
Gene symbol-
Locus tagECED1_2261
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]2198922..2199650 [+]
Productputative type IV secretory pathway VirB1 component
Component typeVirB1
UniProt IDB7MWI2
KEGG IDecq:ECED1_2261
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 7.9e-21, Aligned region: 15..148
Protein Sequence: 242 a.a.     [Download]
>gi|218689988|ref|YP_002398200.1| putative type IV secretory pathway VirB1 component [Escherichia coli ED1a]
MFTEVTMLSTTAFLAIAMQCAASIHPSTAFDVARVESGFNPYAIAEIVPKAGPSFGDQHIISHLPASRGD
AEHILRRLSAQDRRYSVGLMQITSTNFRHYGVSATELLDPCTNLSVFEHILRDCYRRGGTLKRALSCYYS
GNFSTGQQPETAFSGTSYIQRIGYPPGSSRYAVPGTREDKSSVAVPLKTAPASDSSRHHVFWPGVVVRGV
PAKLRQEKIFIAPFSAPSVRRSFSLSPREEEE
 
Nucleotide Sequence: 729 bp     [Download]
>ref|NC_011745.1|:2198922-2199650 putative type IV secretory pathway VirB1 component [Escherichia coli ED1a]
TTGTTTACTGAGGTCACCATGCTTTCCACCACAGCCTTTCTGGCGATAGCCATGCAGTGCGCCGCCAGCA
TTCATCCGTCCACGGCATTCGACGTGGCACGGGTGGAATCCGGTTTTAACCCTTATGCCATCGCTGAGAT
TGTCCCGAAGGCCGGCCCCTCTTTCGGCGATCAACACATTATTTCTCACCTGCCAGCCAGCCGGGGAGAT
GCAGAGCATATTCTCCGTCGCCTGTCAGCACAGGATCGCCGTTACTCTGTCGGGCTGATGCAAATCACCA
GCACCAATTTCCGCCATTATGGTGTGTCCGCCACAGAGCTACTTGATCCCTGTACCAATCTGTCCGTCTT
CGAACACATTCTCAGAGACTGCTACCGGCGCGGCGGCACGCTGAAAAGGGCGCTGAGTTGTTATTATTCC
GGCAATTTCAGTACCGGGCAACAACCTGAAACGGCGTTTTCCGGAACGAGCTATATCCAGCGAATCGGTT
ATCCGCCGGGATCATCCCGCTATGCGGTCCCCGGAACCCGTGAGGACAAATCATCAGTTGCCGTTCCCCT
GAAAACCGCCCCTGCCAGTGACTCATCCCGTCACCACGTGTTCTGGCCCGGAGTCGTCGTCCGTGGCGTC
CCTGCGAAACTCCGCCAAGAAAAAATCTTCATCGCACCTTTCTCCGCGCCGTCAGTGCGCCGGAGTTTCT
CCCTGTCACCCCGTGAGGAGGAGGAATAA
 Primer design