SecReT4
Protein ID: 218689990
T4SS name [ID]VirB [402]
Gene symbol-
Locus tagECED1_2263
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]2199956..2202694 [+]
Productputative type IV secretory pathway VirB4 component
Component typeVirB4
UniProt IDB7MWI4
KEGG IDecq:ECED1_2263
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 5.8e-47, Aligned region: 269..470
AAA_10 [PF12846], Evalue: 1.4e-24, Aligned region: 533..823
VirB3 [PF05101], Evalue: 2.1e-08, Aligned region: 4..81
Protein Sequence: 912 a.a.     [Download]
>gi|218689990|ref|YP_002398202.1| putative type IV secretory pathway VirB4 component [Escherichia coli ED1a]
MAKLLKAMKRPAALWGVPMVPLLAVTGVTIIVAIWTSVALLFLLPVQFLVMKSLTRNEPMRFNLIAVWLR
AKGKPVANRLFGATTFMPVEHDDVDIKEFLDAMKLNQCATIKKYIPYSSHIHQHVVRSPKSDLYCTWELM
GTPFDCESDESLQFGTNQLHGLIRSFEGMPVTFYIHNDRNTFTDNLHKDSGNPYADEVSRLYYASVGLFR
RNRLFLTVCYRPFVSLEKAERKRMKDSQKLKELDGALLEMLEIKSTLDTALSRYGARPLGTFTEGNAVFS
SQLAFYEYLLTHQWRKVRVTRTPAYDVMGAAALFFSAESGQINHANGTQYFRGLEVKEFAEETATGMMDS
LLYAPCDYVITQSYTCMSREEAKKAIKRTRRLLMSADDDAVSQRLDLDVALDLLTSGKIAYGKHHFSIMV
YSPSLESLVADTNEISNALNNIGITPVPAEISLSAAYMAQLPGNYNLRPRKGELSSQNFVELAALHNFYP
GKRDKAPWGDAMALLRTPSGDGYYINLHNTLADKDEFNEKNPASTCILGTNGSGKTMLMTFFEIMQQKYG
REDSFSPDAKTKRLTTVYLDKDRGAEMNIRALGGRYYRVISGESTGWNPFSLPATKRNINFIKQLMKILC
TRNGSTISPRDERRLSDAVNAVMNDEPQYRVYGITRMLENLPEPATKEAQENGLSIRLSQWAQGGEFGWV
FDNESDTFDISNCDNFGIDGTEFLDDASVCAPISFYLLYRITSLLDGRRLVIFMDEFWKWLRDPVFKDFA
YNKLKTIRKLNGMLVVGTQSPAEIIKDDIAPAVIEQCGTQILAANPNADRAHYVDGMKFEPEVFDVVKGL
DPQARQYVVVKNQFKRGDTKRFAARVTLDLSGIGRYTKVMSGDAPNLEIFESIYREGMQPHEWLDTYLAK
AL
 
Nucleotide Sequence: 2739 bp     [Download]
>ref|NC_011745.1|:2199956-2202694 putative type IV secretory pathway VirB4 component [Escherichia coli ED1a]
ATGGCAAAGCTGCTCAAGGCAATGAAACGCCCGGCGGCGCTGTGGGGGGTGCCAATGGTGCCCCTGCTGG
CTGTCACGGGTGTAACCATCATCGTTGCTATCTGGACTTCCGTCGCTCTCCTGTTCTTACTTCCTGTGCA
ATTTCTGGTGATGAAGTCCCTTACCAGAAATGAACCGATGCGGTTCAATCTGATTGCCGTATGGCTGAGA
GCGAAGGGAAAGCCGGTAGCAAACCGTTTATTTGGCGCAACAACATTTATGCCCGTTGAGCATGATGATG
TTGATATCAAGGAGTTTCTCGACGCCATGAAACTAAATCAGTGTGCCACCATCAAGAAGTACATCCCGTA
CTCATCGCACATTCATCAGCATGTGGTTCGTTCCCCTAAGAGCGATCTGTACTGCACCTGGGAATTGATG
GGAACGCCGTTCGACTGCGAGTCTGACGAGTCGCTCCAGTTCGGGACGAACCAGTTACACGGGCTAATCC
GCTCATTCGAAGGTATGCCAGTTACTTTCTATATCCATAACGACCGCAATACGTTTACCGACAATCTTCA
TAAAGATTCCGGCAACCCGTATGCCGATGAAGTTAGCCGTCTTTACTACGCTTCTGTCGGTCTGTTCCGG
CGCAACCGCCTGTTCCTGACGGTCTGCTATCGCCCGTTTGTCAGCCTTGAAAAAGCAGAACGCAAACGGA
TGAAAGACAGCCAGAAACTAAAGGAGCTGGACGGTGCTTTGCTGGAAATGCTGGAAATAAAAAGCACGCT
CGATACCGCGCTGTCGCGCTATGGTGCGCGACCTCTCGGTACGTTTACCGAAGGAAACGCGGTGTTTTCG
TCGCAACTGGCTTTCTATGAATATCTGCTAACGCACCAGTGGCGAAAAGTGCGCGTCACCCGTACCCCGG
CCTATGACGTGATGGGGGCGGCGGCGTTGTTCTTTTCGGCTGAATCCGGGCAGATAAACCACGCCAACGG
TACGCAATATTTCCGGGGGCTGGAGGTTAAAGAGTTCGCCGAAGAGACCGCCACGGGGATGATGGACTCC
CTTCTTTACGCCCCCTGCGATTACGTGATCACGCAGTCCTATACATGCATGTCACGCGAGGAAGCGAAGA
AAGCCATTAAGCGTACCCGCCGCCTTTTGATGAGTGCCGACGACGATGCTGTTTCCCAGCGGCTGGATCT
GGATGTGGCGCTTGACCTGCTGACATCGGGGAAAATCGCTTACGGCAAGCACCATTTTTCCATCATGGTG
TATTCCCCGTCGCTGGAAAGCCTGGTTGCTGATACGAATGAAATCAGTAACGCGCTGAACAACATAGGGA
TAACGCCTGTTCCGGCAGAAATATCGCTTTCAGCGGCGTATATGGCGCAACTGCCAGGCAACTACAACCT
GAGGCCACGTAAAGGGGAGCTGAGTAGCCAGAACTTTGTGGAGCTGGCCGCGCTCCATAATTTCTATCCG
GGCAAGCGCGATAAAGCCCCCTGGGGGGATGCGATGGCTTTACTGCGCACCCCGTCAGGCGATGGCTACT
ATATCAACCTGCATAACACACTGGCAGATAAGGACGAATTCAACGAGAAGAACCCGGCCAGTACCTGCAT
CCTCGGTACGAACGGTTCGGGTAAAACCATGTTGATGACGTTCTTTGAGATCATGCAGCAGAAATACGGG
CGCGAGGATAGCTTCTCCCCGGATGCCAAAACCAAACGGCTGACAACCGTTTACCTCGATAAAGACCGGG
GCGCAGAGATGAACATCCGGGCGCTGGGTGGCCGTTACTATCGGGTTATCAGTGGTGAGTCTACAGGGTG
GAACCCGTTCTCGTTGCCAGCAACCAAACGCAATATCAATTTCATCAAGCAACTGATGAAAATCCTTTGT
ACCCGTAACGGCTCGACGATCTCCCCACGCGATGAACGCCGTCTGAGTGATGCGGTCAATGCTGTGATGA
ATGACGAGCCGCAATATCGCGTCTACGGCATTACCCGAATGCTGGAAAATTTGCCTGAGCCGGCTACGAA
AGAAGCCCAGGAAAACGGCCTTAGCATTCGGTTGTCACAGTGGGCGCAGGGCGGTGAGTTCGGCTGGGTG
TTTGATAACGAGTCTGACACGTTCGATATCAGCAACTGCGATAACTTCGGCATCGACGGAACGGAGTTCC
TGGACGATGCAAGCGTATGTGCGCCAATCTCGTTTTATCTGCTGTACCGCATTACCAGCCTGCTTGACGG
GCGACGCCTGGTCATTTTCATGGATGAATTCTGGAAGTGGTTACGCGACCCGGTGTTTAAGGACTTTGCT
TATAACAAGCTGAAAACCATCCGTAAGCTGAACGGGATGCTGGTCGTCGGTACTCAATCCCCGGCAGAGA
TCATCAAAGATGATATCGCCCCGGCAGTGATTGAGCAGTGCGGGACACAGATTCTGGCGGCGAACCCCAA
CGCCGACCGCGCACACTATGTTGACGGTATGAAGTTTGAACCGGAAGTGTTCGACGTGGTGAAAGGGCTT
GACCCGCAAGCCCGCCAGTATGTTGTGGTGAAAAATCAGTTCAAGCGCGGCGATACCAAACGTTTTGCCG
CTCGTGTCACGCTCGACCTGTCGGGTATCGGCAGATACACCAAAGTCATGAGCGGCGATGCCCCCAACCT
CGAAATATTCGAATCGATTTACCGGGAAGGAATGCAGCCTCATGAATGGCTCGATACCTACCTGGCTAAA
GCGCTCTGA
 Primer design