SecReT4
Protein ID: 218689991
T4SS name [ID]VirB [402]
Gene symbol-
Locus tagECED1_2264
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]2202712..2203419 [+]
Productputative type IV secretory pathway VirB5 component
Component typeVirB5
UniProt IDB7MW63
KEGG IDecq:ECED1_2264
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 6e-41, Aligned region: 22..216
Protein Sequence: 235 a.a.     [Download]
>gi|218689991|ref|YP_002398203.1| putative type IV secretory pathway VirB5 component [Escherichia coli ED1a]
MKTRFRTLILACVIASPLAHAGIPVAVDADPMRDVQWAQELKRWMETARHYQSQIQAYKDQLATATGVRD
IADFVDQAKGLKADLEKLRKPGQALNDLLLSGGSSGQFDALYEKYKIFDTCNTAQSGSYANVCKQQVINK
AIQLEQTDEVQNQVSQTLGEINSLSNRVALAKDSKESQDLANSIQLKSVMLNTLTTQWEMSVKAAEKREN
ALEAERVKQWNQQQLNAPTADLNNL
 
Nucleotide Sequence: 708 bp     [Download]
>ref|NC_011745.1|:2202712-2203419 putative type IV secretory pathway VirB5 component [Escherichia coli ED1a]
ATGAAAACTCGCTTTCGTACTCTTATTCTGGCTTGCGTCATTGCAAGCCCACTGGCTCATGCTGGTATTC
CCGTCGCTGTTGATGCTGACCCTATGCGGGACGTGCAGTGGGCGCAGGAGTTAAAACGCTGGATGGAAAC
GGCCAGACACTACCAGTCACAAATACAGGCATATAAAGACCAACTGGCGACGGCCACTGGCGTTCGTGAT
ATTGCTGATTTTGTTGACCAGGCCAAAGGCCTGAAAGCTGACCTTGAAAAGCTGCGTAAGCCCGGACAGG
CACTGAATGACCTGCTTCTCTCCGGCGGTTCCTCCGGGCAGTTCGATGCGTTGTACGAGAAGTATAAAAT
TTTCGACACCTGCAACACTGCGCAATCGGGGAGTTATGCCAACGTATGCAAGCAGCAGGTCATCAACAAG
GCTATCCAGCTTGAGCAAACCGACGAGGTTCAGAACCAGGTAAGCCAGACCCTGGGGGAAATAAACAGTC
TCTCCAACAGGGTAGCGTTAGCCAAAGATTCGAAAGAATCTCAAGACCTTGCAAACAGTATTCAGCTAAA
ATCTGTCATGCTGAACACGCTTACCACCCAATGGGAAATGAGCGTGAAAGCAGCAGAGAAGCGCGAAAAT
GCGCTAGAAGCGGAGCGTGTTAAGCAGTGGAATCAGCAGCAGTTAAACGCGCCAACTGCTGACCTTAATA
ATTTATGA
 Primer design