SecReT4
Protein ID: 218689993
T4SS name [ID]VirB [402]
Gene symbol-
Locus tagECED1_2266
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]2203673..2204746 [+]
Productputative type IV secretory pathway VirB6 component
Component typeVirB6
UniProt IDB7MWI7
KEGG IDecq:ECED1_2266
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 5.9e-47, Aligned region: 40..259
Protein Sequence: 357 a.a.     [Download]
>gi|218689993|ref|YP_002398205.1| putative type IV secretory pathway VirB6 component [Escherichia coli ED1a]
MSGGLFVGVEKYLIGGITDATKRLMMSYSSMMMGLAAASATIYIMWRGYQTLAGKLSTPMEDTMWDIMRM
AIILSFVANLGGYLDGVIDAINGIKEGFSGSDNIWQLLDTLWNKAKVLGKTLHDMDNSTYVKDEGMTAQF
CVWLGIFALMILAGFVSMVAEVMILLLGITAPIFIFCLMYGFLRPMFNNWLQNIFAGILTILFTALSLRI
VVNYLNLVLNKATKVADSSTIVELGAQVCLAGIFAAILVYISAKVAAALAGASATVSMQGLAAVGIGAAA
FGAGKLAGGAVKETKRSAQDNIQGWKDANAGKPGKPGGELGYNASKARKYAIEQMIARNEARRLAQSRES
AVKKFNS
 
Nucleotide Sequence: 1074 bp     [Download]
>ref|NC_011745.1|:2203673-2204746 putative type IV secretory pathway VirB6 component [Escherichia coli ED1a]
ATGAGTGGCGGTCTTTTTGTTGGGGTTGAGAAATACCTGATAGGAGGAATTACAGACGCCACAAAGAGAT
TGATGATGTCGTACTCTTCTATGATGATGGGGTTGGCAGCAGCGTCAGCTACCATCTACATCATGTGGCG
TGGATACCAGACTTTGGCTGGTAAGCTATCTACGCCTATGGAAGACACGATGTGGGACATCATGAGGATG
GCGATCATCCTGTCCTTCGTGGCTAATTTAGGCGGCTACCTCGATGGCGTTATTGATGCCATAAACGGAA
TAAAGGAGGGTTTTTCTGGTAGTGATAATATATGGCAGTTATTAGACACCCTATGGAATAAGGCTAAAGT
GTTAGGGAAAACGCTACATGACATGGATAATTCTACATATGTAAAAGATGAGGGAATGACTGCTCAATTT
TGTGTATGGCTTGGAATATTCGCACTTATGATTCTAGCGGGCTTTGTTTCAATGGTTGCCGAAGTAATGA
TTCTACTATTAGGAATAACTGCACCTATTTTCATATTCTGCCTTATGTATGGTTTCCTCCGCCCCATGTT
CAATAACTGGTTGCAAAATATATTTGCAGGAATATTAACAATTCTATTTACCGCTCTCTCATTGAGAATT
GTAGTGAATTACTTGAATCTCGTTCTTAATAAGGCGACGAAGGTAGCAGACAGTTCAACAATTGTTGAAC
TTGGTGCTCAAGTCTGCCTTGCAGGTATTTTCGCTGCAATACTGGTGTATATTTCCGCTAAGGTAGCCGC
AGCTCTGGCCGGGGCAAGCGCTACCGTATCCATGCAGGGGCTGGCCGCTGTAGGTATCGGTGCGGCTGCT
TTTGGTGCCGGGAAGCTAGCCGGGGGTGCAGTTAAAGAAACCAAACGTTCCGCCCAGGACAACATTCAGG
GCTGGAAGGATGCGAATGCAGGTAAGCCCGGCAAGCCCGGAGGTGAGTTAGGCTATAACGCATCTAAAGC
GCGGAAGTACGCGATTGAGCAGATGATAGCCCGGAACGAAGCGCGGAGGCTGGCACAGTCGAGAGAATCC
GCGGTTAAGAAGTTCAACAGCTAG
 Primer design