SecReT4
Protein ID: 218689994
T4SS name [ID]VirB [402]
Gene symbol-
Locus tagECED1_2267
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]2204968..2205651 [+]
Productputative type IV secretory pathway VirB8 component
Component typeVirB8
UniProt IDB7MWI8
KEGG IDecq:ECED1_2267
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4e-50, Aligned region: 10..222
Protein Sequence: 227 a.a.     [Download]
>gi|218689994|ref|YP_002398206.1| putative type IV secretory pathway VirB8 component [Escherichia coli ED1a]
MSEQKLIAESRTFEQQMIERDKRATKAGFVVGGMGLLIAVLALVAVVVMLPLKQTDVELYTLDNHTGRVE
HVTRTSKTSLTATEAYQKAMAANYVKVRERYVYPSLQDDYETVQVYNAPQVNDDYLALYAGKNAPDKVYK
NGAHTVKVEILSNQITDATAPDRVATIRYKKIIRRLADNSTRNEYWDARFTFHSNPDKEMSDAEREINYF
GFTVTSWQTDREIRGGE
 
Nucleotide Sequence: 684 bp     [Download]
>ref|NC_011745.1|:2204968-2205651 putative type IV secretory pathway VirB8 component [Escherichia coli ED1a]
ATGAGTGAACAGAAATTAATAGCTGAATCCCGCACTTTTGAGCAGCAAATGATTGAGCGGGATAAACGCG
CCACAAAAGCCGGTTTTGTTGTTGGCGGTATGGGTCTGCTGATTGCGGTACTGGCGCTCGTCGCCGTGGT
CGTGATGTTGCCGCTGAAACAGACGGACGTTGAGCTGTATACCTTGGATAACCACACAGGACGGGTGGAA
CACGTTACCCGGACATCGAAAACCAGCCTGACCGCAACAGAAGCCTATCAAAAGGCGATGGCCGCAAACT
ACGTCAAAGTGCGTGAGCGGTATGTCTATCCCTCTTTGCAGGACGACTACGAGACGGTACAGGTCTACAA
CGCTCCCCAGGTAAACGATGACTATCTGGCGCTTTACGCCGGAAAAAACGCCCCAGACAAGGTTTATAAG
AACGGGGCGCACACCGTGAAAGTGGAGATCTTGTCCAACCAGATCACCGATGCGACAGCCCCTGATAGGG
TCGCCACCATCCGCTACAAGAAGATTATCCGCCGTCTGGCTGATAACAGCACCCGCAACGAATATTGGGA
TGCCCGGTTCACGTTCCATTCTAACCCTGACAAGGAAATGAGCGATGCGGAACGCGAGATCAACTACTTC
GGCTTTACCGTCACCAGTTGGCAGACCGACCGCGAAATCCGGGGAGGTGAATGA
 Primer design