SecReT4
Protein ID: 218689995
T4SS name [ID]VirB [402]
Gene symbol-
Locus tagECED1_2268
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]2205648..2206556 [+]
Productputative type IV secretory pathway VirB9 component
Component typeVirB9
UniProt IDB7MWI9
KEGG IDecq:ECED1_2268
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.5e-55, Aligned region: 30..276
Protein Sequence: 302 a.a.     [Download]
>gi|218689995|ref|YP_002398207.1| putative type IV secretory pathway VirB9 component [Escherichia coli ED1a]
MMKKLTFTALALMMCGAAWAAAIPQASRYDSRVQQVIYNPQNVTVVNTKPGFMTTLVFDNDEAVISAKPG
FDEAWEATPDANRVNVRPVALTQGAPGEDGNTTQVVIPPNSRDWHTNMLVVTSKRLYNVELNVIDDKSAQ
QPAFQVSYRYPGEERDKASREATARQREWEQKQQQASVQKALNSAQTPRNWSYTKYPGKGSFNIVPDFAY
DDGRFTFVGFSPSKSIPSVTKELNGKEHVVNSSIQKKGDFTVLVIQEVTPRLVLRSGNAVVGLENSGFGK
VHAADGSTVSRQVERVEKPESN
 
Nucleotide Sequence: 909 bp     [Download]
>ref|NC_011745.1|:2205648-2206556 putative type IV secretory pathway VirB9 component [Escherichia coli ED1a]
ATGATGAAAAAGTTAACGTTTACCGCACTGGCACTGATGATGTGCGGCGCGGCATGGGCTGCGGCCATAC
CGCAGGCAAGCCGCTATGACTCCCGCGTGCAGCAGGTTATCTATAACCCGCAGAACGTCACTGTCGTTAA
CACCAAACCCGGCTTTATGACAACGCTAGTCTTTGATAACGATGAGGCGGTCATAAGCGCCAAACCTGGC
TTTGATGAGGCGTGGGAAGCCACGCCGGATGCAAACCGGGTCAACGTTCGCCCGGTCGCGCTCACGCAGG
GAGCGCCCGGAGAAGATGGCAACACAACGCAGGTCGTGATCCCCCCGAACAGCCGGGACTGGCATACCAA
TATGCTGGTTGTCACCAGTAAGCGCCTGTACAACGTCGAGCTGAACGTCATCGATGATAAATCGGCACAA
CAACCCGCTTTCCAGGTGAGCTATCGCTATCCGGGCGAAGAACGGGACAAAGCGAGCCGGGAGGCGACGG
CCAGACAGCGCGAGTGGGAGCAGAAACAGCAACAGGCCAGCGTCCAGAAAGCGCTGAACTCGGCGCAGAC
GCCCCGCAACTGGAGTTACACCAAATATCCGGGCAAAGGCAGTTTCAACATTGTTCCCGATTTTGCTTAC
GACGATGGCCGCTTTACGTTCGTGGGCTTCTCCCCGTCTAAGTCCATTCCTTCCGTCACCAAAGAGCTGA
ACGGCAAAGAGCATGTGGTTAACAGCAGTATCCAGAAGAAAGGCGATTTCACCGTACTGGTGATTCAGGA
GGTGACGCCACGCCTAGTACTGCGTTCCGGTAATGCCGTTGTGGGTCTGGAAAATAGCGGATTTGGCAAG
GTACACGCCGCCGATGGTTCCACCGTATCCCGGCAGGTGGAAAGAGTGGAAAAACCGGAATCCAATTAA
 Primer design