SecReT4
Protein ID: 218689996
T4SS name [ID]VirB [402]
Gene symbol-
Locus tagECED1_2269
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]2206586..2207842 [+]
Productputative type IV secretory pathway VirB10 component
Component typeVirB10
UniProt IDB7MWJ0
KEGG IDecq:ECED1_2269
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 5.6e-51, Aligned region: 221..406
Protein Sequence: 418 a.a.     [Download]
>gi|218689996|ref|YP_002398208.1| putative type IV secretory pathway VirB10 component [Escherichia coli ED1a]
MHMNDENKMPVPDEAQAFPAHAEDDIATLEREARAKREAELLNAQDDEEKDPVQPAVNKLKKRKRGKATA
FLAIVAVTLIFLAWGGNWVYRNILWQPTEEKKQDTAPQTNKTDYRQRNDLGMSTDTAEEEPEQQDNGQSS
TGGTGQVAPAAPPELNKASFLIRRDGSATTQNPVKTRQQEMTLTSATTTGQQDSSAATNTAAPPPGQSPA
PLRRIPYNPDLYIPENTSIPCSLDRRFVSDRAGKLRCTVTTDIWSASGNTKLIEKGTTASLLYRAIAEEG
MKHGQGRAFIIATKLRTRQPPYLDIPLVDTSAAGELGEAGVDGWIDSHFWERFGGALMVGMIPDIGAWAS
NSAGKKDRNTDYTENSRQAMADMARTTLENSINIPPTLYKNQGEIINLITGEDIDFSNIYTLRLKNDR
 
Nucleotide Sequence: 1257 bp     [Download]
>ref|NC_011745.1|:2206586-2207842 putative type IV secretory pathway VirB10 component [Escherichia coli ED1a]
GTGCATATGAACGACGAAAACAAAATGCCTGTGCCGGATGAAGCGCAGGCATTCCCGGCACACGCTGAGG
ATGATATTGCCACGCTTGAGCGGGAAGCCCGCGCTAAAAGGGAGGCCGAGCTTCTCAATGCGCAGGACGA
CGAAGAGAAAGACCCGGTACAACCCGCCGTTAACAAGCTGAAAAAGCGCAAACGGGGCAAAGCAACCGCC
TTTCTTGCCATTGTCGCGGTCACGCTTATCTTCCTGGCATGGGGTGGTAACTGGGTTTATCGCAATATCC
TGTGGCAGCCTACGGAAGAAAAGAAACAGGACACAGCCCCGCAGACGAACAAAACCGATTACCGGCAGCG
TAACGATCTCGGTATGTCCACCGATACAGCCGAAGAAGAGCCAGAGCAACAGGATAACGGCCAGAGCAGC
ACGGGGGGAACAGGGCAGGTGGCTCCGGCCGCCCCGCCAGAACTCAACAAAGCCAGCTTCCTTATTCGCC
GTGATGGTTCGGCCACCACACAGAACCCGGTAAAAACCCGGCAGCAGGAAATGACGCTGACATCGGCAAC
GACCACCGGACAACAGGACAGCAGCGCGGCCACAAATACCGCCGCACCGCCGCCGGGACAAAGCCCCGCA
CCACTGCGCCGCATACCCTATAACCCTGACCTGTACATCCCGGAAAATACCTCGATCCCCTGCTCACTGG
ATCGCCGCTTTGTATCTGACCGGGCGGGGAAACTTCGCTGCACGGTCACTACTGACATCTGGAGCGCCAG
CGGCAACACGAAGCTGATAGAGAAAGGCACCACCGCATCATTACTTTACCGCGCCATAGCGGAAGAAGGT
ATGAAGCACGGGCAAGGGCGGGCATTCATCATTGCGACGAAGCTACGCACCCGCCAGCCGCCTTATCTCG
ATATCCCGTTGGTTGATACCAGCGCGGCTGGCGAGCTGGGCGAGGCTGGCGTTGATGGCTGGATAGATTC
GCACTTCTGGGAACGGTTCGGCGGCGCGTTAATGGTCGGCATGATCCCCGATATTGGCGCATGGGCATCC
AACAGCGCGGGTAAAAAAGACCGCAATACGGACTATACGGAAAACAGCCGCCAGGCTATGGCAGATATGG
CACGTACCACGCTAGAGAACAGCATCAATATTCCCCCAACGCTCTATAAGAATCAGGGCGAGATCATCAA
CCTAATCACAGGCGAGGATATTGATTTTTCCAACATCTATACACTGAGGTTGAAAAATGACCGCTAA
 Primer design