SecReT4
Protein ID: 218689997
T4SS name [ID]VirB [402]
Gene symbol-
Locus tagECED1_2270
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]2207832..2208857 [+]
Productputative type IV secretory pathway VirB11 component
Component typeVirB11
UniProt IDB7MWJ1
KEGG IDecq:ECED1_2270
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.7e-46, Aligned region: 18..279
Protein Sequence: 341 a.a.     [Download]
>gi|218689997|ref|YP_002398209.1| putative type IV secretory pathway VirB11 component [Escherichia coli ED1a]
MTAKNISLDRYKQRFFGDFLELPGLTEIAVNRPGELYTKINGVWEQHAVPLSYEDCYNFARCLAKHHGDN
IEDIKPGLSATLESGERCQVIVPPACERDTVSITIRKPSKVQIPHQSYIDAGFYNRVTGEEKTETHDEEL
IALYNTKNIPLFMEKCVEYGKTLAVAGETSTGKTTYMKMLIGYIPVHLRISTIEDNPEITFFIHKNYVHL
FYPSESSDEKGSIVTPASLLRWNYRMNPDRILLTEVRGAEAWDFLKITGSGHEGSMTSIHAGSAKEAIDG
FITRCYENPQCAQLPYTFMLRKVLDSLDVIVSIDLDGNVRRMNDIYFRPIHRNQYFEEMKA
 
Nucleotide Sequence: 1026 bp     [Download]
>ref|NC_011745.1|:2207832-2208857 putative type IV secretory pathway VirB11 component [Escherichia coli ED1a]
ATGACCGCTAAGAATATTTCCCTCGACCGCTATAAACAGCGTTTCTTTGGCGACTTTCTAGAGCTTCCCG
GCCTGACGGAGATCGCCGTCAATCGTCCAGGTGAGCTGTATACCAAAATCAACGGCGTATGGGAGCAGCA
CGCCGTTCCTTTGTCCTATGAGGATTGCTACAACTTTGCCCGGTGCCTGGCAAAGCACCACGGCGACAAT
ATCGAAGATATTAAGCCGGGGCTGTCAGCCACGCTGGAATCTGGCGAACGGTGCCAGGTGATTGTTCCCC
CGGCCTGTGAGCGCGATACGGTGTCTATCACCATCCGTAAGCCATCGAAGGTACAAATCCCGCATCAGTC
ATACATCGATGCGGGATTTTATAACCGGGTAACAGGCGAGGAAAAAACGGAGACGCACGACGAGGAATTA
ATTGCATTGTACAATACAAAAAATATTCCTCTGTTTATGGAGAAATGCGTCGAGTACGGTAAAACTCTCG
CGGTCGCCGGGGAAACAAGCACCGGGAAAACCACCTATATGAAAATGTTGATAGGGTATATTCCTGTACA
TCTTCGGATATCAACCATTGAGGACAACCCGGAAATCACGTTCTTTATCCATAAAAACTACGTCCATCTT
TTTTATCCGTCAGAATCATCAGATGAAAAAGGTTCTATCGTTACCCCGGCGAGCCTTTTACGCTGGAATT
ACCGTATGAACCCTGACCGCATTTTATTAACAGAGGTTCGCGGTGCGGAAGCCTGGGACTTCCTTAAAAT
AACAGGTTCCGGCCATGAAGGGAGTATGACCTCCATTCATGCAGGATCAGCGAAAGAAGCTATAGATGGG
TTTATTACCCGTTGCTATGAAAATCCACAGTGCGCCCAGCTCCCCTATACATTTATGTTACGTAAGGTTC
TGGATAGCCTGGACGTGATTGTGAGCATTGATTTAGACGGAAATGTTCGCCGTATGAATGACATCTATTT
CCGTCCAATTCATCGAAACCAGTATTTTGAGGAAATGAAAGCATGA
 Primer design